GBREL.TXT Genetic Sequence Data Bank June 15 2024 NCBI-GenBank Flat File Release 261.0 Distribution Release Notes 251094334 sequences, 3387240663231 bases, for traditional GenBank records 4263077655 sequences, 28650117876455 bases, for set-based (WGS/TSA/TLS) records This document describes the format and content of the flat files that comprise releases of the GenBank nucleotide sequence database. If you have any questions or comments about GenBank or this document, please contact NCBI via email at info@ncbi.nlm.nih.gov or: GenBank National Center for Biotechnology Information National Library of Medicine, 38A, 8N805 8600 Rockville Pike Bethesda, MD 20894 USA GenBank releases do not include sequence records that originate from third-parties (TPA) or from NCBI's Reference Sequence (RefSeq) project. Rather, GenBank is the archival/primary resource which those other efforts draw upon. For information about TPA and RefSeq, please visit: http://www.ncbi.nih.gov/Genbank/TPA.html http://www.ncbi.nlm.nih.gov/RefSeq ========================================================================== TABLE OF CONTENTS ========================================================================== 1. INTRODUCTION 1.1 Release 261.0 1.2 Cutoff Date 1.3 Important Changes in Release 261.0 1.4 Upcoming Changes 1.5 Request for Direct Submission of Sequence Data 1.6 Organization of This Document 2. ORGANIZATION OF DATA FILES 2.1 Overview 2.2 Files 2.2.1 File Descriptions 2.2.5 File Sizes 2.2.6 Per-Division Statistics 2.2.7 Selected Per-Organism Statistics 2.2.8 Growth of GenBank 3. FILE FORMATS 3.1 File Header Information 3.4 Sequence Entry Files 3.4.1 File Organization 3.4.2 Entry Organization 3.4.3 Sample Sequence Data File 3.4.4 LOCUS Format 3.4.5 DEFINITION Format 3.4.5.1 DEFINITION Format for NLM Entries 3.4.6 ACCESSION Format 3.4.7 VERSION Format 3.4.8 KEYWORDS Format 3.4.9 SEGMENT Format 3.4.10 SOURCE Format 3.4.11 REFERENCE Format 3.4.12 FEATURES Format 3.4.12.1 Feature Key Names 3.4.12.2 Feature Location 3.4.12.3 Feature Qualifiers 3.4.12.4 Cross-Reference Information 3.4.12.5 Feature Table Examples 3.4.13 ORIGIN Format 3.4.14 SEQUENCE Format 3.4.15 CONTIG Format 4. ALTERNATE RELEASES 5. KNOWN PROBLEMS OF THE GENBANK DATABASE 5.1 Incorrect Gene Symbols in Entries 6. GENBANK ADMINISTRATION 6.1 Registered Trademark Notice 6.2 Citing GenBank 6.3 GenBank Distribution Formats and Media 6.4 Other Methods of Accessing GenBank Data 6.5 Request for Corrections and Comments 6.6 Credits and Acknowledgments 6.7 Disclaimer ========================================================================== 1. INTRODUCTION 1.1 Release 261.0 The National Center for Biotechnology Information (NCBI) at the National Library of Medicine (NLM), National Institutes of Health (NIH) is responsible for producing and distributing the GenBank Sequence Database. NCBI handles all GenBank direct submissions and authors are advised to use the address below. Submitters are encouraged to use Submission Portal or BankIt for sending sequence data. ***************************************************************************** The address for direct submissions to GenBank is: GenBank Submissions National Center for Biotechnology Information Bldg 38A, Rm. 8N-803 8600 Rockville Pike Bethesda, MD 20894 Email: gb-sub@ncbi.nlm.nih.gov Updates and changes to existing GenBank records: https://www.ncbi.nlm.nih.gov/genbank/update/ Email: update@ncbi.nlm.nih.gov URLs for GenBank's web-based submission tools: Submission Portal https://submit.ncbi.nlm.nih.gov/ BankIt https://www.ncbi.nlm.nih.gov/WebSub/ See Section 1.5 for additional details about submitting data to GenBank. ***************************************************************************** GenBank Release 261.0 is a release of sequence data by NCBI in the GenBank Flatfile format. GenBank is a component of a tri-partite collaboration of sequence databases in the U.S., Europe, and Japan, known as the International Nucleotide Sequence Database Collaboration (INSDC). The collaborating databases are the European Nucleotide Archive (ENA) at Hinxton Hall, UK, and the DNA Database of Japan (DDBJ) in Mishima. Japan. Patent sequences are incorporated through arrangements with the U.S. Patent and Trademark Office, and via the collaborating international databases from other international patent offices. The database is converted to various output formats, including the GenBank Flatfile and Abstract Syntax Notation 1 (ASN.1) versions. The ASN.1 and Flatfile forms of the data are available at NCBI's anonymous FTP server : ftp://ftp.ncbi.nih.gov/ncbi-asn1 ftp://ftp.ncbi.nih.gov/genbank GenBank releases do not contain sequence records that originate from unfinished Whole Genome Shotgun (WGS) genome sequencing projects, Transcriptome Shotgun Assembly (TSA) RNA sequencing projects, or from Targeted Locus Study (TLS) sequencing projects. The sequence data from those efforts are made available separately, on a per-project basis: ftp://ftp.ncbi.nih.gov/genbank/wgs ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs ftp://ftp.ncbi.nih.gov/genbank/tsa ftp://ftp.ncbi.nih.gov/ncbi-asn1/tsa ftp://ftp.ncbi.nih.gov/genbank/tls ftp://ftp.ncbi.nih.gov/ncbi-asn1/tls See the README files in those areas for more information. Mirrors of NCBI's GenBank FTP site are sometimes available from alternate sites. For example: ftp://lucid.bic.nus.edu.sg/biomirrors/genbank/ Some users who experience slow FTP transfers of large files might realize an improvement in transfer rates from a mirror site when the volume of traffic at the NCBI is high. 1.2 Cutoff Date This full release, 261.0, incorporates data processed by the INSDC databases as of Saturday December 16 at 11:22PM EST. For more recent data, users are advised to: o Download GenBank Incremental Update (GIU) files by anonymous FTP from NCBI: ftp://ftp.ncbi.nih.gov/ncbi-asn1/daily-nc (ASN.1 format) ftp://ftp.ncbi.nih.gov/genbank/daily-nc (flatfile format) o Use the interactive Network-Entrez or Web-Entrez applications to query the 'Entrez: Nucleotide' database (see Section 6.4 of this document). 1.3 Important Changes in Release 261.0 1.3.1 Organizational changes The number of sequence data files for GenBank 261.0 has been reduced by about 50 percent, from 10,388 (Release 260.0) to 5,024 (Release 261.0). Sequencing efforts such as the Darwin Tree of Life project have yielded a growing number of single, traditional (non-WGS) chromosomal sequence records that are gigabase in scale. Given our 500 megabyte target for the size of uncompressed sequence files, this has resulted in a growing number of files containing just one or two sequence records (which naturally can exceed the 500MB target, given the many gigabase-scale records that now exist). For GenBank 260.0 there were 2,753 such files. To address this problem, the target size was tripled to 1.5 gigabytes, resulting in approximately half the total number of sequence files, of which just 1,363 contain only one or two records. Given this reduction, the usual per-division description of sequence file increases is not possible. We will resume providing that information as of GenBank Release 262.0 . 1.3.2 The /country qualifier has transitioned to /geo_loc_name As of this June 2024 GenBank Release 262.0, the name of the "country" qualifier has been changed to "geo_loc_name", to reflect the fact that it is used for geographic features (for example: islands, oceans and seas) in addition to country names. For further information, please see: https://ncbiinsights.ncbi.nlm.nih.gov/2023/12/14/update-genbank-qualifier/ 1.4 Upcoming Changes 1.4.1 New allowed values for the /geo_loc_name and /collection_date qualifiers The INSDC will begin to mandate inclusion of /geo_loc_name (formerly /country) and /collection_date for sequence submissions, in alignment with its goal of increasing the number of sequences for which the origin of a sample can be precisely located in time and space. This requirement is expected to take effect by the end of December 2024, and further details can be found at: https://www.insdc.org/news/insdc-spatiotemporal-metadata-minimum-standards-update-03-03-2023/ Because there are valid circumstances in which location and/or the collection date for a sequenced sample cannot be provided, the domain of allowed values for these two source-feature qualifiers will be expanded to include a variety of "null terms". They are: missing not applicable not collected not provided restricted access missing: control sample missing: sample group missing: synthetic construct missing: lab stock missing: third party data missing: data agreement established pre-2023 missing: endangered species missing: human-identifiable The timeframe for introducing these new values is still uncertain, but the earliest possible date for their appearance was June 15 2023. 1.5 Request for Direct Submission of Sequence Data A successful GenBank requires that sequence data enter the database as soon as possible after publication, that the annotations be as complete as possible, and that the sequence and annotation data be accurate. All three of these requirements are best met if authors of sequence data submit their data directly to GenBank utilizing the tools summarized below. GenBank must rely on direct author submission of data to ensure that it achieves its goals of completeness, accuracy, and timeliness. General information for submitting to Genbank is available online: https://www.ncbi.nlm.nih.gov/genbank/submit/ To assist researchers in entering their own sequence data, GenBank provides Web-based submission tools: Submission Portal and Bankit. Submission Portal https://submit.ncbi.nlm.nih.gov/ BankIt https://www.ncbi.nlm.nih.gov/WebSub/ Submission Portal provides an efficient submission pathway for high frequency submission types (e.g., 16S rRNA, rRNA-ITS, metazoan COX1, SARS-CoV-2, etc.). BankIt is an easy-to-use program that enables authors to enter one or more sequences, annotate, and submit to GenBank. BankIt provides a simple forms-based approach for submitting your sequence and the relevant associated metadata to GenBank. Genbank also provides submission preparation tools which require uploading via the Submission Portal or email to gb-sub@ncbi.nlm.nih.gov when relevant: table2asn: https://www.ncbi.nlm.nih.gov/genbank/table2asn/ table2asn is a command-line program that automates the creation of sequence records for submission to GenBank. It is used primarily for submission of complete genomes and large batches of sequences and is available by FTP for use on MAC, PC and Unix platforms: https://ftp.ncbi.nlm.nih.gov/asn1-converters/by_program/table2asn/ Genome Workbench offers a rich set of integrated tools for studying and analyzing genetic data. The Submission Wizard allows you to prepare submissions of single eukaryotic and prokaryotic genomes. You can also use Genome Workbench to edit and visualize an ASN.1 file created by table2asn. Genome Workbench: https://www.ncbi.nlm.nih.gov/tools/gbench/ Through the international collaboration of DNA sequence databases, GenBank submissions are forwarded daily for inclusion in the European Nucleotide Archive (ENA) and the DNA Databank of Japan (DDBJ). AUTHORIN. Authorin sequence submissions are no longer accepted by GenBank, and the Authorin application is no longer distributed by NCBI. SEQUIN. As of January 2021, Sequin sequence submissions are no longer accepted by GenBank, and the Sequin application is no longer distributed by NCBI. See: https://ncbiinsights.ncbi.nlm.nih.gov/tag/sequin/ If you have questions about GenBank submissions or any of the data submission tools, contact NCBI at: info@ncbi.nlm.nih.gov . 1.6 Organization of This Document The second section describes the contents of GenBank releases. The third section illustrates the formats of the flat files. The fourth section describes other versions of the data, the fifth section identifies known prob- lems, and the sixth contains administrative details. 2. ORGANIZATION OF DATA FILES 2.1 Overview GenBank releases consist of a set of ASCII text files, most of which contain sequence data. A few supplemental files are also supplied, containing lists of new, modified, and deleted sequence records. The line-lengths of these files is variable. 2.2 Files This GenBank flat file release consists of 5028 files. The lists that follow describe each of the files included in the distribution. Their sizes and base pair content are also summarized. 2.2.1 File Descriptions Files included in this release are: 1. gbbct1.seq - Bacterial sequence entries, part 1. 2. gbbct10.seq - Bacterial sequence entries, part 10. 3. gbbct100.seq - Bacterial sequence entries, part 100. 4. gbbct101.seq - Bacterial sequence entries, part 101. 5. gbbct102.seq - Bacterial sequence entries, part 102. 6. gbbct103.seq - Bacterial sequence entries, part 103. 7. gbbct104.seq - Bacterial sequence entries, part 104. 8. gbbct105.seq - Bacterial sequence entries, part 105. 9. gbbct106.seq - Bacterial sequence entries, part 106. 10. gbbct107.seq - Bacterial sequence entries, part 107. 11. gbbct108.seq - Bacterial sequence entries, part 108. 12. gbbct109.seq - Bacterial sequence entries, part 109. 13. gbbct11.seq - Bacterial sequence entries, part 11. 14. gbbct110.seq - Bacterial sequence entries, part 110. 15. gbbct111.seq - Bacterial sequence entries, part 111. 16. gbbct112.seq - Bacterial sequence entries, part 112. 17. gbbct113.seq - Bacterial sequence entries, part 113. 18. gbbct114.seq - Bacterial sequence entries, part 114. 19. gbbct115.seq - Bacterial sequence entries, part 115. 20. gbbct116.seq - Bacterial sequence entries, part 116. 21. gbbct117.seq - Bacterial sequence entries, part 117. 22. gbbct118.seq - Bacterial sequence entries, part 118. 23. gbbct119.seq - Bacterial sequence entries, part 119. 24. gbbct12.seq - Bacterial sequence entries, part 12. 25. gbbct120.seq - Bacterial sequence entries, part 120. 26. gbbct121.seq - Bacterial sequence entries, part 121. 27. gbbct122.seq - Bacterial sequence entries, part 122. 28. gbbct123.seq - Bacterial sequence entries, part 123. 29. gbbct124.seq - Bacterial sequence entries, part 124. 30. gbbct125.seq - Bacterial sequence entries, part 125. 31. gbbct126.seq - Bacterial sequence entries, part 126. 32. gbbct127.seq - Bacterial sequence entries, part 127. 33. gbbct128.seq - Bacterial sequence entries, part 128. 34. gbbct129.seq - Bacterial sequence entries, part 129. 35. gbbct13.seq - Bacterial sequence entries, part 13. 36. gbbct130.seq - Bacterial sequence entries, part 130. 37. gbbct131.seq - Bacterial sequence entries, part 131. 38. gbbct132.seq - Bacterial sequence entries, part 132. 39. gbbct133.seq - Bacterial sequence entries, part 133. 40. gbbct134.seq - Bacterial sequence entries, part 134. 41. gbbct135.seq - Bacterial sequence entries, part 135. 42. gbbct136.seq - Bacterial sequence entries, part 136. 43. gbbct137.seq - Bacterial sequence entries, part 137. 44. gbbct138.seq - Bacterial sequence entries, part 138. 45. gbbct139.seq - Bacterial sequence entries, part 139. 46. gbbct14.seq - Bacterial sequence entries, part 14. 47. gbbct140.seq - Bacterial sequence entries, part 140. 48. gbbct141.seq - Bacterial sequence entries, part 141. 49. gbbct142.seq - Bacterial sequence entries, part 142. 50. gbbct143.seq - Bacterial sequence entries, part 143. 51. gbbct144.seq - Bacterial sequence entries, part 144. 52. gbbct145.seq - Bacterial sequence entries, part 145. 53. gbbct146.seq - Bacterial sequence entries, part 146. 54. gbbct147.seq - Bacterial sequence entries, part 147. 55. gbbct148.seq - Bacterial sequence entries, part 148. 56. gbbct149.seq - Bacterial sequence entries, part 149. 57. gbbct15.seq - Bacterial sequence entries, part 15. 58. gbbct150.seq - Bacterial sequence entries, part 150. 59. gbbct151.seq - Bacterial sequence entries, part 151. 60. gbbct152.seq - Bacterial sequence entries, part 152. 61. gbbct153.seq - Bacterial sequence entries, part 153. 62. gbbct154.seq - Bacterial sequence entries, part 154. 63. gbbct155.seq - Bacterial sequence entries, part 155. 64. gbbct156.seq - Bacterial sequence entries, part 156. 65. gbbct157.seq - Bacterial sequence entries, part 157. 66. gbbct158.seq - Bacterial sequence entries, part 158. 67. gbbct159.seq - Bacterial sequence entries, part 159. 68. gbbct16.seq - Bacterial sequence entries, part 16. 69. gbbct160.seq - Bacterial sequence entries, part 160. 70. gbbct161.seq - Bacterial sequence entries, part 161. 71. gbbct162.seq - Bacterial sequence entries, part 162. 72. gbbct163.seq - Bacterial sequence entries, part 163. 73. gbbct164.seq - Bacterial sequence entries, part 164. 74. gbbct165.seq - Bacterial sequence entries, part 165. 75. gbbct166.seq - Bacterial sequence entries, part 166. 76. gbbct167.seq - Bacterial sequence entries, part 167. 77. gbbct168.seq - Bacterial sequence entries, part 168. 78. gbbct169.seq - Bacterial sequence entries, part 169. 79. gbbct17.seq - Bacterial sequence entries, part 17. 80. gbbct170.seq - Bacterial sequence entries, part 170. 81. gbbct171.seq - Bacterial sequence entries, part 171. 82. gbbct172.seq - Bacterial sequence entries, part 172. 83. gbbct173.seq - Bacterial sequence entries, part 173. 84. gbbct174.seq - Bacterial sequence entries, part 174. 85. gbbct175.seq - Bacterial sequence entries, part 175. 86. gbbct176.seq - Bacterial sequence entries, part 176. 87. gbbct177.seq - Bacterial sequence entries, part 177. 88. gbbct178.seq - Bacterial sequence entries, part 178. 89. gbbct179.seq - Bacterial sequence entries, part 179. 90. gbbct18.seq - Bacterial sequence entries, part 18. 91. gbbct180.seq - Bacterial sequence entries, part 180. 92. gbbct181.seq - Bacterial sequence entries, part 181. 93. gbbct182.seq - Bacterial sequence entries, part 182. 94. gbbct183.seq - Bacterial sequence entries, part 183. 95. gbbct184.seq - Bacterial sequence entries, part 184. 96. gbbct185.seq - Bacterial sequence entries, part 185. 97. gbbct186.seq - Bacterial sequence entries, part 186. 98. gbbct187.seq - Bacterial sequence entries, part 187. 99. gbbct188.seq - Bacterial sequence entries, part 188. 100. gbbct189.seq - Bacterial sequence entries, part 189. 101. gbbct19.seq - Bacterial sequence entries, part 19. 102. gbbct190.seq - Bacterial sequence entries, part 190. 103. gbbct191.seq - Bacterial sequence entries, part 191. 104. gbbct192.seq - Bacterial sequence entries, part 192. 105. gbbct193.seq - Bacterial sequence entries, part 193. 106. gbbct194.seq - Bacterial sequence entries, part 194. 107. gbbct195.seq - Bacterial sequence entries, part 195. 108. gbbct196.seq - Bacterial sequence entries, part 196. 109. gbbct197.seq - Bacterial sequence entries, part 197. 110. gbbct198.seq - Bacterial sequence entries, part 198. 111. gbbct199.seq - Bacterial sequence entries, part 199. 112. gbbct2.seq - Bacterial sequence entries, part 2. 113. gbbct20.seq - Bacterial sequence entries, part 20. 114. gbbct200.seq - Bacterial sequence entries, part 200. 115. gbbct201.seq - Bacterial sequence entries, part 201. 116. gbbct202.seq - Bacterial sequence entries, part 202. 117. gbbct203.seq - Bacterial sequence entries, part 203. 118. gbbct204.seq - Bacterial sequence entries, part 204. 119. gbbct205.seq - Bacterial sequence entries, part 205. 120. gbbct206.seq - Bacterial sequence entries, part 206. 121. gbbct207.seq - Bacterial sequence entries, part 207. 122. gbbct208.seq - Bacterial sequence entries, part 208. 123. gbbct209.seq - Bacterial sequence entries, part 209. 124. gbbct21.seq - Bacterial sequence entries, part 21. 125. gbbct210.seq - Bacterial sequence entries, part 210. 126. gbbct211.seq - Bacterial sequence entries, part 211. 127. gbbct212.seq - Bacterial sequence entries, part 212. 128. gbbct213.seq - Bacterial sequence entries, part 213. 129. gbbct214.seq - Bacterial sequence entries, part 214. 130. gbbct215.seq - Bacterial sequence entries, part 215. 131. gbbct216.seq - Bacterial sequence entries, part 216. 132. gbbct217.seq - Bacterial sequence entries, part 217. 133. gbbct218.seq - Bacterial sequence entries, part 218. 134. gbbct219.seq - Bacterial sequence entries, part 219. 135. gbbct22.seq - Bacterial sequence entries, part 22. 136. gbbct220.seq - Bacterial sequence entries, part 220. 137. gbbct221.seq - Bacterial sequence entries, part 221. 138. gbbct222.seq - Bacterial sequence entries, part 222. 139. gbbct223.seq - Bacterial sequence entries, part 223. 140. gbbct224.seq - Bacterial sequence entries, part 224. 141. gbbct225.seq - Bacterial sequence entries, part 225. 142. gbbct226.seq - Bacterial sequence entries, part 226. 143. gbbct227.seq - Bacterial sequence entries, part 227. 144. gbbct228.seq - Bacterial sequence entries, part 228. 145. gbbct229.seq - Bacterial sequence entries, part 229. 146. gbbct23.seq - Bacterial sequence entries, part 23. 147. gbbct230.seq - Bacterial sequence entries, part 230. 148. gbbct231.seq - Bacterial sequence entries, part 231. 149. gbbct232.seq - Bacterial sequence entries, part 232. 150. gbbct233.seq - Bacterial sequence entries, part 233. 151. gbbct234.seq - Bacterial sequence entries, part 234. 152. gbbct235.seq - Bacterial sequence entries, part 235. 153. gbbct236.seq - Bacterial sequence entries, part 236. 154. gbbct237.seq - Bacterial sequence entries, part 237. 155. gbbct238.seq - Bacterial sequence entries, part 238. 156. gbbct239.seq - Bacterial sequence entries, part 239. 157. gbbct24.seq - Bacterial sequence entries, part 24. 158. gbbct240.seq - Bacterial sequence entries, part 240. 159. gbbct241.seq - Bacterial sequence entries, part 241. 160. gbbct242.seq - Bacterial sequence entries, part 242. 161. gbbct243.seq - Bacterial sequence entries, part 243. 162. gbbct244.seq - Bacterial sequence entries, part 244. 163. gbbct245.seq - Bacterial sequence entries, part 245. 164. gbbct246.seq - Bacterial sequence entries, part 246. 165. gbbct247.seq - Bacterial sequence entries, part 247. 166. gbbct248.seq - Bacterial sequence entries, part 248. 167. gbbct249.seq - Bacterial sequence entries, part 249. 168. gbbct25.seq - Bacterial sequence entries, part 25. 169. gbbct250.seq - Bacterial sequence entries, part 250. 170. gbbct251.seq - Bacterial sequence entries, part 251. 171. gbbct252.seq - Bacterial sequence entries, part 252. 172. gbbct253.seq - Bacterial sequence entries, part 253. 173. gbbct254.seq - Bacterial sequence entries, part 254. 174. gbbct255.seq - Bacterial sequence entries, part 255. 175. gbbct256.seq - Bacterial sequence entries, part 256. 176. gbbct257.seq - Bacterial sequence entries, part 257. 177. gbbct258.seq - Bacterial sequence entries, part 258. 178. gbbct259.seq - Bacterial sequence entries, part 259. 179. gbbct26.seq - Bacterial sequence entries, part 26. 180. gbbct260.seq - Bacterial sequence entries, part 260. 181. gbbct261.seq - Bacterial sequence entries, part 261. 182. gbbct262.seq - Bacterial sequence entries, part 262. 183. gbbct263.seq - Bacterial sequence entries, part 263. 184. gbbct264.seq - Bacterial sequence entries, part 264. 185. gbbct265.seq - Bacterial sequence entries, part 265. 186. gbbct266.seq - Bacterial sequence entries, part 266. 187. gbbct267.seq - Bacterial sequence entries, part 267. 188. gbbct268.seq - Bacterial sequence entries, part 268. 189. gbbct269.seq - Bacterial sequence entries, part 269. 190. gbbct27.seq - Bacterial sequence entries, part 27. 191. gbbct270.seq - Bacterial sequence entries, part 270. 192. gbbct271.seq - Bacterial sequence entries, part 271. 193. gbbct272.seq - Bacterial sequence entries, part 272. 194. gbbct273.seq - Bacterial sequence entries, part 273. 195. gbbct274.seq - Bacterial sequence entries, part 274. 196. gbbct275.seq - Bacterial sequence entries, part 275. 197. gbbct276.seq - Bacterial sequence entries, part 276. 198. gbbct277.seq - Bacterial sequence entries, part 277. 199. gbbct278.seq - Bacterial sequence entries, part 278. 200. gbbct279.seq - Bacterial sequence entries, part 279. 201. gbbct28.seq - Bacterial sequence entries, part 28. 202. gbbct280.seq - Bacterial sequence entries, part 280. 203. gbbct281.seq - Bacterial sequence entries, part 281. 204. gbbct282.seq - Bacterial sequence entries, part 282. 205. gbbct283.seq - Bacterial sequence entries, part 283. 206. gbbct284.seq - Bacterial sequence entries, part 284. 207. gbbct285.seq - Bacterial sequence entries, part 285. 208. gbbct286.seq - Bacterial sequence entries, part 286. 209. gbbct287.seq - Bacterial sequence entries, part 287. 210. gbbct288.seq - Bacterial sequence entries, part 288. 211. gbbct289.seq - Bacterial sequence entries, part 289. 212. gbbct29.seq - Bacterial sequence entries, part 29. 213. gbbct290.seq - Bacterial sequence entries, part 290. 214. gbbct291.seq - Bacterial sequence entries, part 291. 215. gbbct292.seq - Bacterial sequence entries, part 292. 216. gbbct293.seq - Bacterial sequence entries, part 293. 217. gbbct294.seq - Bacterial sequence entries, part 294. 218. gbbct295.seq - Bacterial sequence entries, part 295. 219. gbbct296.seq - Bacterial sequence entries, part 296. 220. gbbct297.seq - Bacterial sequence entries, part 297. 221. gbbct298.seq - Bacterial sequence entries, part 298. 222. gbbct299.seq - Bacterial sequence entries, part 299. 223. gbbct3.seq - Bacterial sequence entries, part 3. 224. gbbct30.seq - Bacterial sequence entries, part 30. 225. gbbct300.seq - Bacterial sequence entries, part 300. 226. gbbct301.seq - Bacterial sequence entries, part 301. 227. gbbct302.seq - Bacterial sequence entries, part 302. 228. gbbct303.seq - Bacterial sequence entries, part 303. 229. gbbct304.seq - Bacterial sequence entries, part 304. 230. gbbct305.seq - Bacterial sequence entries, part 305. 231. gbbct306.seq - Bacterial sequence entries, part 306. 232. gbbct307.seq - Bacterial sequence entries, part 307. 233. gbbct308.seq - Bacterial sequence entries, part 308. 234. gbbct309.seq - Bacterial sequence entries, part 309. 235. gbbct31.seq - Bacterial sequence entries, part 31. 236. gbbct310.seq - Bacterial sequence entries, part 310. 237. gbbct311.seq - Bacterial sequence entries, part 311. 238. gbbct312.seq - Bacterial sequence entries, part 312. 239. gbbct313.seq - Bacterial sequence entries, part 313. 240. gbbct314.seq - Bacterial sequence entries, part 314. 241. gbbct315.seq - Bacterial sequence entries, part 315. 242. gbbct316.seq - Bacterial sequence entries, part 316. 243. gbbct317.seq - Bacterial sequence entries, part 317. 244. gbbct318.seq - Bacterial sequence entries, part 318. 245. gbbct319.seq - Bacterial sequence entries, part 319. 246. gbbct32.seq - Bacterial sequence entries, part 32. 247. gbbct320.seq - Bacterial sequence entries, part 320. 248. gbbct321.seq - Bacterial sequence entries, part 321. 249. gbbct322.seq - Bacterial sequence entries, part 322. 250. gbbct323.seq - Bacterial sequence entries, part 323. 251. gbbct324.seq - Bacterial sequence entries, part 324. 252. gbbct325.seq - Bacterial sequence entries, part 325. 253. gbbct326.seq - Bacterial sequence entries, part 326. 254. gbbct327.seq - Bacterial sequence entries, part 327. 255. gbbct328.seq - Bacterial sequence entries, part 328. 256. gbbct329.seq - Bacterial sequence entries, part 329. 257. gbbct33.seq - Bacterial sequence entries, part 33. 258. gbbct330.seq - Bacterial sequence entries, part 330. 259. gbbct331.seq - Bacterial sequence entries, part 331. 260. gbbct332.seq - Bacterial sequence entries, part 332. 261. gbbct333.seq - Bacterial sequence entries, part 333. 262. gbbct334.seq - Bacterial sequence entries, part 334. 263. gbbct335.seq - Bacterial sequence entries, part 335. 264. gbbct336.seq - Bacterial sequence entries, part 336. 265. gbbct337.seq - Bacterial sequence entries, part 337. 266. gbbct338.seq - Bacterial sequence entries, part 338. 267. gbbct339.seq - Bacterial sequence entries, part 339. 268. gbbct34.seq - Bacterial sequence entries, part 34. 269. gbbct340.seq - Bacterial sequence entries, part 340. 270. gbbct341.seq - Bacterial sequence entries, part 341. 271. gbbct342.seq - Bacterial sequence entries, part 342. 272. gbbct343.seq - Bacterial sequence entries, part 343. 273. gbbct344.seq - Bacterial sequence entries, part 344. 274. gbbct345.seq - Bacterial sequence entries, part 345. 275. gbbct346.seq - Bacterial sequence entries, part 346. 276. gbbct347.seq - Bacterial sequence entries, part 347. 277. gbbct348.seq - Bacterial sequence entries, part 348. 278. gbbct349.seq - Bacterial sequence entries, part 349. 279. gbbct35.seq - Bacterial sequence entries, part 35. 280. gbbct350.seq - Bacterial sequence entries, part 350. 281. gbbct351.seq - Bacterial sequence entries, part 351. 282. gbbct352.seq - Bacterial sequence entries, part 352. 283. gbbct353.seq - Bacterial sequence entries, part 353. 284. gbbct354.seq - Bacterial sequence entries, part 354. 285. gbbct355.seq - Bacterial sequence entries, part 355. 286. gbbct356.seq - Bacterial sequence entries, part 356. 287. gbbct357.seq - Bacterial sequence entries, part 357. 288. gbbct358.seq - Bacterial sequence entries, part 358. 289. gbbct359.seq - Bacterial sequence entries, part 359. 290. gbbct36.seq - Bacterial sequence entries, part 36. 291. gbbct360.seq - Bacterial sequence entries, part 360. 292. gbbct361.seq - Bacterial sequence entries, part 361. 293. gbbct362.seq - Bacterial sequence entries, part 362. 294. gbbct363.seq - Bacterial sequence entries, part 363. 295. gbbct364.seq - Bacterial sequence entries, part 364. 296. gbbct365.seq - Bacterial sequence entries, part 365. 297. gbbct366.seq - Bacterial sequence entries, part 366. 298. gbbct367.seq - Bacterial sequence entries, part 367. 299. gbbct368.seq - Bacterial sequence entries, part 368. 300. gbbct369.seq - Bacterial sequence entries, part 369. 301. gbbct37.seq - Bacterial sequence entries, part 37. 302. gbbct370.seq - Bacterial sequence entries, part 370. 303. gbbct371.seq - Bacterial sequence entries, part 371. 304. gbbct372.seq - Bacterial sequence entries, part 372. 305. gbbct373.seq - Bacterial sequence entries, part 373. 306. gbbct374.seq - Bacterial sequence entries, part 374. 307. gbbct375.seq - Bacterial sequence entries, part 375. 308. gbbct376.seq - Bacterial sequence entries, part 376. 309. gbbct377.seq - Bacterial sequence entries, part 377. 310. gbbct378.seq - Bacterial sequence entries, part 378. 311. gbbct379.seq - Bacterial sequence entries, part 379. 312. gbbct38.seq - Bacterial sequence entries, part 38. 313. gbbct380.seq - Bacterial sequence entries, part 380. 314. gbbct381.seq - Bacterial sequence entries, part 381. 315. gbbct382.seq - Bacterial sequence entries, part 382. 316. gbbct383.seq - Bacterial sequence entries, part 383. 317. gbbct384.seq - Bacterial sequence entries, part 384. 318. gbbct385.seq - Bacterial sequence entries, part 385. 319. gbbct386.seq - Bacterial sequence entries, part 386. 320. gbbct387.seq - Bacterial sequence entries, part 387. 321. gbbct388.seq - Bacterial sequence entries, part 388. 322. gbbct389.seq - Bacterial sequence entries, part 389. 323. gbbct39.seq - Bacterial sequence entries, part 39. 324. gbbct390.seq - Bacterial sequence entries, part 390. 325. gbbct391.seq - Bacterial sequence entries, part 391. 326. gbbct392.seq - Bacterial sequence entries, part 392. 327. gbbct393.seq - Bacterial sequence entries, part 393. 328. gbbct394.seq - Bacterial sequence entries, part 394. 329. gbbct395.seq - Bacterial sequence entries, part 395. 330. gbbct396.seq - Bacterial sequence entries, part 396. 331. gbbct397.seq - Bacterial sequence entries, part 397. 332. gbbct398.seq - Bacterial sequence entries, part 398. 333. gbbct399.seq - Bacterial sequence entries, part 399. 334. gbbct4.seq - Bacterial sequence entries, part 4. 335. gbbct40.seq - Bacterial sequence entries, part 40. 336. gbbct400.seq - Bacterial sequence entries, part 400. 337. gbbct401.seq - Bacterial sequence entries, part 401. 338. gbbct402.seq - Bacterial sequence entries, part 402. 339. gbbct403.seq - Bacterial sequence entries, part 403. 340. gbbct404.seq - Bacterial sequence entries, part 404. 341. gbbct405.seq - Bacterial sequence entries, part 405. 342. gbbct406.seq - Bacterial sequence entries, part 406. 343. gbbct407.seq - Bacterial sequence entries, part 407. 344. gbbct408.seq - Bacterial sequence entries, part 408. 345. gbbct409.seq - Bacterial sequence entries, part 409. 346. gbbct41.seq - Bacterial sequence entries, part 41. 347. gbbct410.seq - Bacterial sequence entries, part 410. 348. gbbct411.seq - Bacterial sequence entries, part 411. 349. gbbct412.seq - Bacterial sequence entries, part 412. 350. gbbct413.seq - Bacterial sequence entries, part 413. 351. gbbct414.seq - Bacterial sequence entries, part 414. 352. gbbct415.seq - Bacterial sequence entries, part 415. 353. gbbct416.seq - Bacterial sequence entries, part 416. 354. gbbct417.seq - Bacterial sequence entries, part 417. 355. gbbct418.seq - Bacterial sequence entries, part 418. 356. gbbct419.seq - Bacterial sequence entries, part 419. 357. gbbct42.seq - Bacterial sequence entries, part 42. 358. gbbct420.seq - Bacterial sequence entries, part 420. 359. gbbct421.seq - Bacterial sequence entries, part 421. 360. gbbct422.seq - Bacterial sequence entries, part 422. 361. gbbct423.seq - Bacterial sequence entries, part 423. 362. gbbct424.seq - Bacterial sequence entries, part 424. 363. gbbct425.seq - Bacterial sequence entries, part 425. 364. gbbct426.seq - Bacterial sequence entries, part 426. 365. gbbct427.seq - Bacterial sequence entries, part 427. 366. gbbct428.seq - Bacterial sequence entries, part 428. 367. gbbct429.seq - Bacterial sequence entries, part 429. 368. gbbct43.seq - Bacterial sequence entries, part 43. 369. gbbct430.seq - Bacterial sequence entries, part 430. 370. gbbct431.seq - Bacterial sequence entries, part 431. 371. gbbct432.seq - Bacterial sequence entries, part 432. 372. gbbct433.seq - Bacterial sequence entries, part 433. 373. gbbct434.seq - Bacterial sequence entries, part 434. 374. gbbct435.seq - Bacterial sequence entries, part 435. 375. gbbct436.seq - Bacterial sequence entries, part 436. 376. gbbct437.seq - Bacterial sequence entries, part 437. 377. gbbct438.seq - Bacterial sequence entries, part 438. 378. gbbct439.seq - Bacterial sequence entries, part 439. 379. gbbct44.seq - Bacterial sequence entries, part 44. 380. gbbct440.seq - Bacterial sequence entries, part 440. 381. gbbct441.seq - Bacterial sequence entries, part 441. 382. gbbct442.seq - Bacterial sequence entries, part 442. 383. gbbct443.seq - Bacterial sequence entries, part 443. 384. gbbct444.seq - Bacterial sequence entries, part 444. 385. gbbct445.seq - Bacterial sequence entries, part 445. 386. gbbct446.seq - Bacterial sequence entries, part 446. 387. gbbct447.seq - Bacterial sequence entries, part 447. 388. gbbct448.seq - Bacterial sequence entries, part 448. 389. gbbct449.seq - Bacterial sequence entries, part 449. 390. gbbct45.seq - Bacterial sequence entries, part 45. 391. gbbct450.seq - Bacterial sequence entries, part 450. 392. gbbct451.seq - Bacterial sequence entries, part 451. 393. gbbct452.seq - Bacterial sequence entries, part 452. 394. gbbct453.seq - Bacterial sequence entries, part 453. 395. gbbct454.seq - Bacterial sequence entries, part 454. 396. gbbct455.seq - Bacterial sequence entries, part 455. 397. gbbct456.seq - Bacterial sequence entries, part 456. 398. gbbct457.seq - Bacterial sequence entries, part 457. 399. gbbct458.seq - Bacterial sequence entries, part 458. 400. gbbct459.seq - Bacterial sequence entries, part 459. 401. gbbct46.seq - Bacterial sequence entries, part 46. 402. gbbct460.seq - Bacterial sequence entries, part 460. 403. gbbct461.seq - Bacterial sequence entries, part 461. 404. gbbct462.seq - Bacterial sequence entries, part 462. 405. gbbct463.seq - Bacterial sequence entries, part 463. 406. gbbct464.seq - Bacterial sequence entries, part 464. 407. gbbct465.seq - Bacterial sequence entries, part 465. 408. gbbct466.seq - Bacterial sequence entries, part 466. 409. gbbct467.seq - Bacterial sequence entries, part 467. 410. gbbct468.seq - Bacterial sequence entries, part 468. 411. gbbct469.seq - Bacterial sequence entries, part 469. 412. gbbct47.seq - Bacterial sequence entries, part 47. 413. gbbct470.seq - Bacterial sequence entries, part 470. 414. gbbct471.seq - Bacterial sequence entries, part 471. 415. gbbct472.seq - Bacterial sequence entries, part 472. 416. gbbct473.seq - Bacterial sequence entries, part 473. 417. gbbct474.seq - Bacterial sequence entries, part 474. 418. gbbct475.seq - Bacterial sequence entries, part 475. 419. gbbct476.seq - Bacterial sequence entries, part 476. 420. gbbct477.seq - Bacterial sequence entries, part 477. 421. gbbct478.seq - Bacterial sequence entries, part 478. 422. gbbct479.seq - Bacterial sequence entries, part 479. 423. gbbct48.seq - Bacterial sequence entries, part 48. 424. gbbct480.seq - Bacterial sequence entries, part 480. 425. gbbct481.seq - Bacterial sequence entries, part 481. 426. gbbct482.seq - Bacterial sequence entries, part 482. 427. gbbct483.seq - Bacterial sequence entries, part 483. 428. gbbct484.seq - Bacterial sequence entries, part 484. 429. gbbct485.seq - Bacterial sequence entries, part 485. 430. gbbct486.seq - Bacterial sequence entries, part 486. 431. gbbct487.seq - Bacterial sequence entries, part 487. 432. gbbct488.seq - Bacterial sequence entries, part 488. 433. gbbct489.seq - Bacterial sequence entries, part 489. 434. gbbct49.seq - Bacterial sequence entries, part 49. 435. gbbct5.seq - Bacterial sequence entries, part 5. 436. gbbct50.seq - Bacterial sequence entries, part 50. 437. gbbct51.seq - Bacterial sequence entries, part 51. 438. gbbct52.seq - Bacterial sequence entries, part 52. 439. gbbct53.seq - Bacterial sequence entries, part 53. 440. gbbct54.seq - Bacterial sequence entries, part 54. 441. gbbct55.seq - Bacterial sequence entries, part 55. 442. gbbct56.seq - Bacterial sequence entries, part 56. 443. gbbct57.seq - Bacterial sequence entries, part 57. 444. gbbct58.seq - Bacterial sequence entries, part 58. 445. gbbct59.seq - Bacterial sequence entries, part 59. 446. gbbct6.seq - Bacterial sequence entries, part 6. 447. gbbct60.seq - Bacterial sequence entries, part 60. 448. gbbct61.seq - Bacterial sequence entries, part 61. 449. gbbct62.seq - Bacterial sequence entries, part 62. 450. gbbct63.seq - Bacterial sequence entries, part 63. 451. gbbct64.seq - Bacterial sequence entries, part 64. 452. gbbct65.seq - Bacterial sequence entries, part 65. 453. gbbct66.seq - Bacterial sequence entries, part 66. 454. gbbct67.seq - Bacterial sequence entries, part 67. 455. gbbct68.seq - Bacterial sequence entries, part 68. 456. gbbct69.seq - Bacterial sequence entries, part 69. 457. gbbct7.seq - Bacterial sequence entries, part 7. 458. gbbct70.seq - Bacterial sequence entries, part 70. 459. gbbct71.seq - Bacterial sequence entries, part 71. 460. gbbct72.seq - Bacterial sequence entries, part 72. 461. gbbct73.seq - Bacterial sequence entries, part 73. 462. gbbct74.seq - Bacterial sequence entries, part 74. 463. gbbct75.seq - Bacterial sequence entries, part 75. 464. gbbct76.seq - Bacterial sequence entries, part 76. 465. gbbct77.seq - Bacterial sequence entries, part 77. 466. gbbct78.seq - Bacterial sequence entries, part 78. 467. gbbct79.seq - Bacterial sequence entries, part 79. 468. gbbct8.seq - Bacterial sequence entries, part 8. 469. gbbct80.seq - Bacterial sequence entries, part 80. 470. gbbct81.seq - Bacterial sequence entries, part 81. 471. gbbct82.seq - Bacterial sequence entries, part 82. 472. gbbct83.seq - Bacterial sequence entries, part 83. 473. gbbct84.seq - Bacterial sequence entries, part 84. 474. gbbct85.seq - Bacterial sequence entries, part 85. 475. gbbct86.seq - Bacterial sequence entries, part 86. 476. gbbct87.seq - Bacterial sequence entries, part 87. 477. gbbct88.seq - Bacterial sequence entries, part 88. 478. gbbct89.seq - Bacterial sequence entries, part 89. 479. gbbct9.seq - Bacterial sequence entries, part 9. 480. gbbct90.seq - Bacterial sequence entries, part 90. 481. gbbct91.seq - Bacterial sequence entries, part 91. 482. gbbct92.seq - Bacterial sequence entries, part 92. 483. gbbct93.seq - Bacterial sequence entries, part 93. 484. gbbct94.seq - Bacterial sequence entries, part 94. 485. gbbct95.seq - Bacterial sequence entries, part 95. 486. gbbct96.seq - Bacterial sequence entries, part 96. 487. gbbct97.seq - Bacterial sequence entries, part 97. 488. gbbct98.seq - Bacterial sequence entries, part 98. 489. gbbct99.seq - Bacterial sequence entries, part 99. 490. gbchg.txt - Accession numbers of entries updated since the previous release. 491. gbcon1.seq - Constructed sequence entries, part 1. 492. gbcon10.seq - Constructed sequence entries, part 10. 493. gbcon100.seq - Constructed sequence entries, part 100. 494. gbcon101.seq - Constructed sequence entries, part 101. 495. gbcon11.seq - Constructed sequence entries, part 11. 496. gbcon12.seq - Constructed sequence entries, part 12. 497. gbcon13.seq - Constructed sequence entries, part 13. 498. gbcon14.seq - Constructed sequence entries, part 14. 499. gbcon15.seq - Constructed sequence entries, part 15. 500. gbcon16.seq - Constructed sequence entries, part 16. 501. gbcon17.seq - Constructed sequence entries, part 17. 502. gbcon18.seq - Constructed sequence entries, part 18. 503. gbcon19.seq - Constructed sequence entries, part 19. 504. gbcon2.seq - Constructed sequence entries, part 2. 505. gbcon20.seq - Constructed sequence entries, part 20. 506. gbcon21.seq - Constructed sequence entries, part 21. 507. gbcon22.seq - Constructed sequence entries, part 22. 508. gbcon23.seq - Constructed sequence entries, part 23. 509. gbcon24.seq - Constructed sequence entries, part 24. 510. gbcon25.seq - Constructed sequence entries, part 25. 511. gbcon26.seq - Constructed sequence entries, part 26. 512. gbcon27.seq - Constructed sequence entries, part 27. 513. gbcon28.seq - Constructed sequence entries, part 28. 514. gbcon29.seq - Constructed sequence entries, part 29. 515. gbcon3.seq - Constructed sequence entries, part 3. 516. gbcon30.seq - Constructed sequence entries, part 30. 517. gbcon31.seq - Constructed sequence entries, part 31. 518. gbcon32.seq - Constructed sequence entries, part 32. 519. gbcon33.seq - Constructed sequence entries, part 33. 520. gbcon34.seq - Constructed sequence entries, part 34. 521. gbcon35.seq - Constructed sequence entries, part 35. 522. gbcon36.seq - Constructed sequence entries, part 36. 523. gbcon37.seq - Constructed sequence entries, part 37. 524. gbcon38.seq - Constructed sequence entries, part 38. 525. gbcon39.seq - Constructed sequence entries, part 39. 526. gbcon4.seq - Constructed sequence entries, part 4. 527. gbcon40.seq - Constructed sequence entries, part 40. 528. gbcon41.seq - Constructed sequence entries, part 41. 529. gbcon42.seq - Constructed sequence entries, part 42. 530. gbcon43.seq - Constructed sequence entries, part 43. 531. gbcon44.seq - Constructed sequence entries, part 44. 532. gbcon45.seq - Constructed sequence entries, part 45. 533. gbcon46.seq - Constructed sequence entries, part 46. 534. gbcon47.seq - Constructed sequence entries, part 47. 535. gbcon48.seq - Constructed sequence entries, part 48. 536. gbcon49.seq - Constructed sequence entries, part 49. 537. gbcon5.seq - Constructed sequence entries, part 5. 538. gbcon50.seq - Constructed sequence entries, part 50. 539. gbcon51.seq - Constructed sequence entries, part 51. 540. gbcon52.seq - Constructed sequence entries, part 52. 541. gbcon53.seq - Constructed sequence entries, part 53. 542. gbcon54.seq - Constructed sequence entries, part 54. 543. gbcon55.seq - Constructed sequence entries, part 55. 544. gbcon56.seq - Constructed sequence entries, part 56. 545. gbcon57.seq - Constructed sequence entries, part 57. 546. gbcon58.seq - Constructed sequence entries, part 58. 547. gbcon59.seq - Constructed sequence entries, part 59. 548. gbcon6.seq - Constructed sequence entries, part 6. 549. gbcon60.seq - Constructed sequence entries, part 60. 550. gbcon61.seq - Constructed sequence entries, part 61. 551. gbcon62.seq - Constructed sequence entries, part 62. 552. gbcon63.seq - Constructed sequence entries, part 63. 553. gbcon64.seq - Constructed sequence entries, part 64. 554. gbcon65.seq - Constructed sequence entries, part 65. 555. gbcon66.seq - Constructed sequence entries, part 66. 556. gbcon67.seq - Constructed sequence entries, part 67. 557. gbcon68.seq - Constructed sequence entries, part 68. 558. gbcon69.seq - Constructed sequence entries, part 69. 559. gbcon7.seq - Constructed sequence entries, part 7. 560. gbcon70.seq - Constructed sequence entries, part 70. 561. gbcon71.seq - Constructed sequence entries, part 71. 562. gbcon72.seq - Constructed sequence entries, part 72. 563. gbcon73.seq - Constructed sequence entries, part 73. 564. gbcon74.seq - Constructed sequence entries, part 74. 565. gbcon75.seq - Constructed sequence entries, part 75. 566. gbcon76.seq - Constructed sequence entries, part 76. 567. gbcon77.seq - Constructed sequence entries, part 77. 568. gbcon78.seq - Constructed sequence entries, part 78. 569. gbcon79.seq - Constructed sequence entries, part 79. 570. gbcon8.seq - Constructed sequence entries, part 8. 571. gbcon80.seq - Constructed sequence entries, part 80. 572. gbcon81.seq - Constructed sequence entries, part 81. 573. gbcon82.seq - Constructed sequence entries, part 82. 574. gbcon83.seq - Constructed sequence entries, part 83. 575. gbcon84.seq - Constructed sequence entries, part 84. 576. gbcon85.seq - Constructed sequence entries, part 85. 577. gbcon86.seq - Constructed sequence entries, part 86. 578. gbcon87.seq - Constructed sequence entries, part 87. 579. gbcon88.seq - Constructed sequence entries, part 88. 580. gbcon89.seq - Constructed sequence entries, part 89. 581. gbcon9.seq - Constructed sequence entries, part 9. 582. gbcon90.seq - Constructed sequence entries, part 90. 583. gbcon91.seq - Constructed sequence entries, part 91. 584. gbcon92.seq - Constructed sequence entries, part 92. 585. gbcon93.seq - Constructed sequence entries, part 93. 586. gbcon94.seq - Constructed sequence entries, part 94. 587. gbcon95.seq - Constructed sequence entries, part 95. 588. gbcon96.seq - Constructed sequence entries, part 96. 589. gbcon97.seq - Constructed sequence entries, part 97. 590. gbcon98.seq - Constructed sequence entries, part 98. 591. gbcon99.seq - Constructed sequence entries, part 99. 592. gbdel.txt - Accession numbers of entries deleted since the previous release. 593. gbenv1.seq - Environmental sampling sequence entries, part 1. 594. gbenv10.seq - Environmental sampling sequence entries, part 10. 595. gbenv11.seq - Environmental sampling sequence entries, part 11. 596. gbenv12.seq - Environmental sampling sequence entries, part 12. 597. gbenv13.seq - Environmental sampling sequence entries, part 13. 598. gbenv14.seq - Environmental sampling sequence entries, part 14. 599. gbenv15.seq - Environmental sampling sequence entries, part 15. 600. gbenv16.seq - Environmental sampling sequence entries, part 16. 601. gbenv17.seq - Environmental sampling sequence entries, part 17. 602. gbenv18.seq - Environmental sampling sequence entries, part 18. 603. gbenv19.seq - Environmental sampling sequence entries, part 19. 604. gbenv2.seq - Environmental sampling sequence entries, part 2. 605. gbenv20.seq - Environmental sampling sequence entries, part 20. 606. gbenv21.seq - Environmental sampling sequence entries, part 21. 607. gbenv22.seq - Environmental sampling sequence entries, part 22. 608. gbenv23.seq - Environmental sampling sequence entries, part 23. 609. gbenv24.seq - Environmental sampling sequence entries, part 24. 610. gbenv25.seq - Environmental sampling sequence entries, part 25. 611. gbenv26.seq - Environmental sampling sequence entries, part 26. 612. gbenv27.seq - Environmental sampling sequence entries, part 27. 613. gbenv28.seq - Environmental sampling sequence entries, part 28. 614. gbenv29.seq - Environmental sampling sequence entries, part 29. 615. gbenv3.seq - Environmental sampling sequence entries, part 3. 616. gbenv30.seq - Environmental sampling sequence entries, part 30. 617. gbenv31.seq - Environmental sampling sequence entries, part 31. 618. gbenv32.seq - Environmental sampling sequence entries, part 32. 619. gbenv33.seq - Environmental sampling sequence entries, part 33. 620. gbenv34.seq - Environmental sampling sequence entries, part 34. 621. gbenv35.seq - Environmental sampling sequence entries, part 35. 622. gbenv36.seq - Environmental sampling sequence entries, part 36. 623. gbenv37.seq - Environmental sampling sequence entries, part 37. 624. gbenv38.seq - Environmental sampling sequence entries, part 38. 625. gbenv4.seq - Environmental sampling sequence entries, part 4. 626. gbenv5.seq - Environmental sampling sequence entries, part 5. 627. gbenv6.seq - Environmental sampling sequence entries, part 6. 628. gbenv7.seq - Environmental sampling sequence entries, part 7. 629. gbenv8.seq - Environmental sampling sequence entries, part 8. 630. gbenv9.seq - Environmental sampling sequence entries, part 9. 631. gbest1.seq - EST (expressed sequence tag) sequence entries, part 1. 632. gbest10.seq - EST (expressed sequence tag) sequence entries, part 10. 633. gbest100.seq - EST (expressed sequence tag) sequence entries, part 100. 634. gbest101.seq - EST (expressed sequence tag) sequence entries, part 101. 635. gbest102.seq - EST (expressed sequence tag) sequence entries, part 102. 636. gbest103.seq - EST (expressed sequence tag) sequence entries, part 103. 637. gbest104.seq - EST (expressed sequence tag) sequence entries, part 104. 638. gbest105.seq - EST (expressed sequence tag) sequence entries, part 105. 639. gbest106.seq - EST (expressed sequence tag) sequence entries, part 106. 640. gbest107.seq - EST (expressed sequence tag) sequence entries, part 107. 641. gbest108.seq - EST (expressed sequence tag) sequence entries, part 108. 642. gbest109.seq - EST (expressed sequence tag) sequence entries, part 109. 643. gbest11.seq - EST (expressed sequence tag) sequence entries, part 11. 644. gbest110.seq - EST (expressed sequence tag) sequence entries, part 110. 645. gbest111.seq - EST (expressed sequence tag) sequence entries, part 111. 646. gbest112.seq - EST (expressed sequence tag) sequence entries, part 112. 647. gbest113.seq - EST (expressed sequence tag) sequence entries, part 113. 648. gbest114.seq - EST (expressed sequence tag) sequence entries, part 114. 649. gbest115.seq - EST (expressed sequence tag) sequence entries, part 115. 650. gbest116.seq - EST (expressed sequence tag) sequence entries, part 116. 651. gbest117.seq - EST (expressed sequence tag) sequence entries, part 117. 652. gbest118.seq - EST (expressed sequence tag) sequence entries, part 118. 653. gbest119.seq - EST (expressed sequence tag) sequence entries, part 119. 654. gbest12.seq - EST (expressed sequence tag) sequence entries, part 12. 655. gbest120.seq - EST (expressed sequence tag) sequence entries, part 120. 656. gbest121.seq - EST (expressed sequence tag) sequence entries, part 121. 657. gbest122.seq - EST (expressed sequence tag) sequence entries, part 122. 658. gbest123.seq - EST (expressed sequence tag) sequence entries, part 123. 659. gbest124.seq - EST (expressed sequence tag) sequence entries, part 124. 660. gbest125.seq - EST (expressed sequence tag) sequence entries, part 125. 661. gbest126.seq - EST (expressed sequence tag) sequence entries, part 126. 662. gbest127.seq - EST (expressed sequence tag) sequence entries, part 127. 663. gbest128.seq - EST (expressed sequence tag) sequence entries, part 128. 664. gbest129.seq - EST (expressed sequence tag) sequence entries, part 129. 665. gbest13.seq - EST (expressed sequence tag) sequence entries, part 13. 666. gbest130.seq - EST (expressed sequence tag) sequence entries, part 130. 667. gbest131.seq - EST (expressed sequence tag) sequence entries, part 131. 668. gbest132.seq - EST (expressed sequence tag) sequence entries, part 132. 669. gbest133.seq - EST (expressed sequence tag) sequence entries, part 133. 670. gbest134.seq - EST (expressed sequence tag) sequence entries, part 134. 671. gbest135.seq - EST (expressed sequence tag) sequence entries, part 135. 672. gbest136.seq - EST (expressed sequence tag) sequence entries, part 136. 673. gbest137.seq - EST (expressed sequence tag) sequence entries, part 137. 674. gbest138.seq - EST (expressed sequence tag) sequence entries, part 138. 675. gbest139.seq - EST (expressed sequence tag) sequence entries, part 139. 676. gbest14.seq - EST (expressed sequence tag) sequence entries, part 14. 677. gbest140.seq - EST (expressed sequence tag) sequence entries, part 140. 678. gbest141.seq - EST (expressed sequence tag) sequence entries, part 141. 679. gbest142.seq - EST (expressed sequence tag) sequence entries, part 142. 680. gbest143.seq - EST (expressed sequence tag) sequence entries, part 143. 681. gbest144.seq - EST (expressed sequence tag) sequence entries, part 144. 682. gbest145.seq - EST (expressed sequence tag) sequence entries, part 145. 683. gbest146.seq - EST (expressed sequence tag) sequence entries, part 146. 684. gbest147.seq - EST (expressed sequence tag) sequence entries, part 147. 685. gbest148.seq - EST (expressed sequence tag) sequence entries, part 148. 686. gbest149.seq - EST (expressed sequence tag) sequence entries, part 149. 687. gbest15.seq - EST (expressed sequence tag) sequence entries, part 15. 688. gbest150.seq - EST (expressed sequence tag) sequence entries, part 150. 689. gbest151.seq - EST (expressed sequence tag) sequence entries, part 151. 690. gbest152.seq - EST (expressed sequence tag) sequence entries, part 152. 691. gbest153.seq - EST (expressed sequence tag) sequence entries, part 153. 692. gbest154.seq - EST (expressed sequence tag) sequence entries, part 154. 693. gbest155.seq - EST (expressed sequence tag) sequence entries, part 155. 694. gbest156.seq - EST (expressed sequence tag) sequence entries, part 156. 695. gbest157.seq - EST (expressed sequence tag) sequence entries, part 157. 696. gbest158.seq - EST (expressed sequence tag) sequence entries, part 158. 697. gbest159.seq - EST (expressed sequence tag) sequence entries, part 159. 698. gbest16.seq - EST (expressed sequence tag) sequence entries, part 16. 699. gbest160.seq - EST (expressed sequence tag) sequence entries, part 160. 700. gbest161.seq - EST (expressed sequence tag) sequence entries, part 161. 701. gbest162.seq - EST (expressed sequence tag) sequence entries, part 162. 702. gbest163.seq - EST (expressed sequence tag) sequence entries, part 163. 703. gbest164.seq - EST (expressed sequence tag) sequence entries, part 164. 704. gbest165.seq - EST (expressed sequence tag) sequence entries, part 165. 705. gbest166.seq - EST (expressed sequence tag) sequence entries, part 166. 706. gbest167.seq - EST (expressed sequence tag) sequence entries, part 167. 707. gbest168.seq - EST (expressed sequence tag) sequence entries, part 168. 708. gbest169.seq - EST (expressed sequence tag) sequence entries, part 169. 709. gbest17.seq - EST (expressed sequence tag) sequence entries, part 17. 710. gbest170.seq - EST (expressed sequence tag) sequence entries, part 170. 711. gbest171.seq - EST (expressed sequence tag) sequence entries, part 171. 712. gbest172.seq - EST (expressed sequence tag) sequence entries, part 172. 713. gbest173.seq - EST (expressed sequence tag) sequence entries, part 173. 714. gbest174.seq - EST (expressed sequence tag) sequence entries, part 174. 715. gbest175.seq - EST (expressed sequence tag) sequence entries, part 175. 716. gbest176.seq - EST (expressed sequence tag) sequence entries, part 176. 717. gbest177.seq - EST (expressed sequence tag) sequence entries, part 177. 718. gbest178.seq - EST (expressed sequence tag) sequence entries, part 178. 719. gbest179.seq - EST (expressed sequence tag) sequence entries, part 179. 720. gbest18.seq - EST (expressed sequence tag) sequence entries, part 18. 721. gbest180.seq - EST (expressed sequence tag) sequence entries, part 180. 722. gbest181.seq - EST (expressed sequence tag) sequence entries, part 181. 723. gbest182.seq - EST (expressed sequence tag) sequence entries, part 182. 724. gbest183.seq - EST (expressed sequence tag) sequence entries, part 183. 725. gbest184.seq - EST (expressed sequence tag) sequence entries, part 184. 726. gbest185.seq - EST (expressed sequence tag) sequence entries, part 185. 727. gbest186.seq - EST (expressed sequence tag) sequence entries, part 186. 728. gbest187.seq - EST (expressed sequence tag) sequence entries, part 187. 729. gbest188.seq - EST (expressed sequence tag) sequence entries, part 188. 730. gbest189.seq - EST (expressed sequence tag) sequence entries, part 189. 731. gbest19.seq - EST (expressed sequence tag) sequence entries, part 19. 732. gbest190.seq - EST (expressed sequence tag) sequence entries, part 190. 733. gbest191.seq - EST (expressed sequence tag) sequence entries, part 191. 734. gbest192.seq - EST (expressed sequence tag) sequence entries, part 192. 735. gbest193.seq - EST (expressed sequence tag) sequence entries, part 193. 736. gbest194.seq - EST (expressed sequence tag) sequence entries, part 194. 737. gbest195.seq - EST (expressed sequence tag) sequence entries, part 195. 738. gbest196.seq - EST (expressed sequence tag) sequence entries, part 196. 739. gbest197.seq - EST (expressed sequence tag) sequence entries, part 197. 740. gbest198.seq - EST (expressed sequence tag) sequence entries, part 198. 741. gbest199.seq - EST (expressed sequence tag) sequence entries, part 199. 742. gbest2.seq - EST (expressed sequence tag) sequence entries, part 2. 743. gbest20.seq - EST (expressed sequence tag) sequence entries, part 20. 744. gbest200.seq - EST (expressed sequence tag) sequence entries, part 200. 745. gbest201.seq - EST (expressed sequence tag) sequence entries, part 201. 746. gbest202.seq - EST (expressed sequence tag) sequence entries, part 202. 747. gbest203.seq - EST (expressed sequence tag) sequence entries, part 203. 748. gbest204.seq - EST (expressed sequence tag) sequence entries, part 204. 749. gbest205.seq - EST (expressed sequence tag) sequence entries, part 205. 750. gbest206.seq - EST (expressed sequence tag) sequence entries, part 206. 751. gbest207.seq - EST (expressed sequence tag) sequence entries, part 207. 752. gbest208.seq - EST (expressed sequence tag) sequence entries, part 208. 753. gbest209.seq - EST (expressed sequence tag) sequence entries, part 209. 754. gbest21.seq - EST (expressed sequence tag) sequence entries, part 21. 755. gbest210.seq - EST (expressed sequence tag) sequence entries, part 210. 756. gbest211.seq - EST (expressed sequence tag) sequence entries, part 211. 757. gbest212.seq - EST (expressed sequence tag) sequence entries, part 212. 758. gbest213.seq - EST (expressed sequence tag) sequence entries, part 213. 759. gbest214.seq - EST (expressed sequence tag) sequence entries, part 214. 760. gbest215.seq - EST (expressed sequence tag) sequence entries, part 215. 761. gbest216.seq - EST (expressed sequence tag) sequence entries, part 216. 762. gbest217.seq - EST (expressed sequence tag) sequence entries, part 217. 763. gbest218.seq - EST (expressed sequence tag) sequence entries, part 218. 764. gbest219.seq - EST (expressed sequence tag) sequence entries, part 219. 765. gbest22.seq - EST (expressed sequence tag) sequence entries, part 22. 766. gbest220.seq - EST (expressed sequence tag) sequence entries, part 220. 767. gbest221.seq - EST (expressed sequence tag) sequence entries, part 221. 768. gbest222.seq - EST (expressed sequence tag) sequence entries, part 222. 769. gbest223.seq - EST (expressed sequence tag) sequence entries, part 223. 770. gbest224.seq - EST (expressed sequence tag) sequence entries, part 224. 771. gbest225.seq - EST (expressed sequence tag) sequence entries, part 225. 772. gbest226.seq - EST (expressed sequence tag) sequence entries, part 226. 773. gbest227.seq - EST (expressed sequence tag) sequence entries, part 227. 774. gbest228.seq - EST (expressed sequence tag) sequence entries, part 228. 775. gbest229.seq - EST (expressed sequence tag) sequence entries, part 229. 776. gbest23.seq - EST (expressed sequence tag) sequence entries, part 23. 777. gbest230.seq - EST (expressed sequence tag) sequence entries, part 230. 778. gbest231.seq - EST (expressed sequence tag) sequence entries, part 231. 779. gbest232.seq - EST (expressed sequence tag) sequence entries, part 232. 780. gbest233.seq - EST (expressed sequence tag) sequence entries, part 233. 781. gbest234.seq - EST (expressed sequence tag) sequence entries, part 234. 782. gbest235.seq - EST (expressed sequence tag) sequence entries, part 235. 783. gbest236.seq - EST (expressed sequence tag) sequence entries, part 236. 784. gbest237.seq - EST (expressed sequence tag) sequence entries, part 237. 785. gbest238.seq - EST (expressed sequence tag) sequence entries, part 238. 786. gbest239.seq - EST (expressed sequence tag) sequence entries, part 239. 787. gbest24.seq - EST (expressed sequence tag) sequence entries, part 24. 788. gbest240.seq - EST (expressed sequence tag) sequence entries, part 240. 789. gbest241.seq - EST (expressed sequence tag) sequence entries, part 241. 790. gbest242.seq - EST (expressed sequence tag) sequence entries, part 242. 791. gbest25.seq - EST (expressed sequence tag) sequence entries, part 25. 792. gbest26.seq - EST (expressed sequence tag) sequence entries, part 26. 793. gbest27.seq - EST (expressed sequence tag) sequence entries, part 27. 794. gbest28.seq - EST (expressed sequence tag) sequence entries, part 28. 795. gbest29.seq - EST (expressed sequence tag) sequence entries, part 29. 796. gbest3.seq - EST (expressed sequence tag) sequence entries, part 3. 797. gbest30.seq - EST (expressed sequence tag) sequence entries, part 30. 798. gbest31.seq - EST (expressed sequence tag) sequence entries, part 31. 799. gbest32.seq - EST (expressed sequence tag) sequence entries, part 32. 800. gbest33.seq - EST (expressed sequence tag) sequence entries, part 33. 801. gbest34.seq - EST (expressed sequence tag) sequence entries, part 34. 802. gbest35.seq - EST (expressed sequence tag) sequence entries, part 35. 803. gbest36.seq - EST (expressed sequence tag) sequence entries, part 36. 804. gbest37.seq - EST (expressed sequence tag) sequence entries, part 37. 805. gbest38.seq - EST (expressed sequence tag) sequence entries, part 38. 806. gbest39.seq - EST (expressed sequence tag) sequence entries, part 39. 807. gbest4.seq - EST (expressed sequence tag) sequence entries, part 4. 808. gbest40.seq - EST (expressed sequence tag) sequence entries, part 40. 809. gbest41.seq - EST (expressed sequence tag) sequence entries, part 41. 810. gbest42.seq - EST (expressed sequence tag) sequence entries, part 42. 811. gbest43.seq - EST (expressed sequence tag) sequence entries, part 43. 812. gbest44.seq - EST (expressed sequence tag) sequence entries, part 44. 813. gbest45.seq - EST (expressed sequence tag) sequence entries, part 45. 814. gbest46.seq - EST (expressed sequence tag) sequence entries, part 46. 815. gbest47.seq - EST (expressed sequence tag) sequence entries, part 47. 816. gbest48.seq - EST (expressed sequence tag) sequence entries, part 48. 817. gbest49.seq - EST (expressed sequence tag) sequence entries, part 49. 818. gbest5.seq - EST (expressed sequence tag) sequence entries, part 5. 819. gbest50.seq - EST (expressed sequence tag) sequence entries, part 50. 820. gbest51.seq - EST (expressed sequence tag) sequence entries, part 51. 821. gbest52.seq - EST (expressed sequence tag) sequence entries, part 52. 822. gbest53.seq - EST (expressed sequence tag) sequence entries, part 53. 823. gbest54.seq - EST (expressed sequence tag) sequence entries, part 54. 824. gbest55.seq - EST (expressed sequence tag) sequence entries, part 55. 825. gbest56.seq - EST (expressed sequence tag) sequence entries, part 56. 826. gbest57.seq - EST (expressed sequence tag) sequence entries, part 57. 827. gbest58.seq - EST (expressed sequence tag) sequence entries, part 58. 828. gbest59.seq - EST (expressed sequence tag) sequence entries, part 59. 829. gbest6.seq - EST (expressed sequence tag) sequence entries, part 6. 830. gbest60.seq - EST (expressed sequence tag) sequence entries, part 60. 831. gbest61.seq - EST (expressed sequence tag) sequence entries, part 61. 832. gbest62.seq - EST (expressed sequence tag) sequence entries, part 62. 833. gbest63.seq - EST (expressed sequence tag) sequence entries, part 63. 834. gbest64.seq - EST (expressed sequence tag) sequence entries, part 64. 835. gbest65.seq - EST (expressed sequence tag) sequence entries, part 65. 836. gbest66.seq - EST (expressed sequence tag) sequence entries, part 66. 837. gbest67.seq - EST (expressed sequence tag) sequence entries, part 67. 838. gbest68.seq - EST (expressed sequence tag) sequence entries, part 68. 839. gbest69.seq - EST (expressed sequence tag) sequence entries, part 69. 840. gbest7.seq - EST (expressed sequence tag) sequence entries, part 7. 841. gbest70.seq - EST (expressed sequence tag) sequence entries, part 70. 842. gbest71.seq - EST (expressed sequence tag) sequence entries, part 71. 843. gbest72.seq - EST (expressed sequence tag) sequence entries, part 72. 844. gbest73.seq - EST (expressed sequence tag) sequence entries, part 73. 845. gbest74.seq - EST (expressed sequence tag) sequence entries, part 74. 846. gbest75.seq - EST (expressed sequence tag) sequence entries, part 75. 847. gbest76.seq - EST (expressed sequence tag) sequence entries, part 76. 848. gbest77.seq - EST (expressed sequence tag) sequence entries, part 77. 849. gbest78.seq - EST (expressed sequence tag) sequence entries, part 78. 850. gbest79.seq - EST (expressed sequence tag) sequence entries, part 79. 851. gbest8.seq - EST (expressed sequence tag) sequence entries, part 8. 852. gbest80.seq - EST (expressed sequence tag) sequence entries, part 80. 853. gbest81.seq - EST (expressed sequence tag) sequence entries, part 81. 854. gbest82.seq - EST (expressed sequence tag) sequence entries, part 82. 855. gbest83.seq - EST (expressed sequence tag) sequence entries, part 83. 856. gbest84.seq - EST (expressed sequence tag) sequence entries, part 84. 857. gbest85.seq - EST (expressed sequence tag) sequence entries, part 85. 858. gbest86.seq - EST (expressed sequence tag) sequence entries, part 86. 859. gbest87.seq - EST (expressed sequence tag) sequence entries, part 87. 860. gbest88.seq - EST (expressed sequence tag) sequence entries, part 88. 861. gbest89.seq - EST (expressed sequence tag) sequence entries, part 89. 862. gbest9.seq - EST (expressed sequence tag) sequence entries, part 9. 863. gbest90.seq - EST (expressed sequence tag) sequence entries, part 90. 864. gbest91.seq - EST (expressed sequence tag) sequence entries, part 91. 865. gbest92.seq - EST (expressed sequence tag) sequence entries, part 92. 866. gbest93.seq - EST (expressed sequence tag) sequence entries, part 93. 867. gbest94.seq - EST (expressed sequence tag) sequence entries, part 94. 868. gbest95.seq - EST (expressed sequence tag) sequence entries, part 95. 869. gbest96.seq - EST (expressed sequence tag) sequence entries, part 96. 870. gbest97.seq - EST (expressed sequence tag) sequence entries, part 97. 871. gbest98.seq - EST (expressed sequence tag) sequence entries, part 98. 872. gbest99.seq - EST (expressed sequence tag) sequence entries, part 99. 873. gbgss1.seq - GSS (genome survey sequence) sequence entries, part 1. 874. gbgss10.seq - GSS (genome survey sequence) sequence entries, part 10. 875. gbgss100.seq - GSS (genome survey sequence) sequence entries, part 100. 876. gbgss101.seq - GSS (genome survey sequence) sequence entries, part 101. 877. gbgss102.seq - GSS (genome survey sequence) sequence entries, part 102. 878. gbgss103.seq - GSS (genome survey sequence) sequence entries, part 103. 879. gbgss104.seq - GSS (genome survey sequence) sequence entries, part 104. 880. gbgss105.seq - GSS (genome survey sequence) sequence entries, part 105. 881. gbgss106.seq - GSS (genome survey sequence) sequence entries, part 106. 882. gbgss107.seq - GSS (genome survey sequence) sequence entries, part 107. 883. gbgss108.seq - GSS (genome survey sequence) sequence entries, part 108. 884. gbgss109.seq - GSS (genome survey sequence) sequence entries, part 109. 885. gbgss11.seq - GSS (genome survey sequence) sequence entries, part 11. 886. gbgss110.seq - GSS (genome survey sequence) sequence entries, part 110. 887. gbgss111.seq - GSS (genome survey sequence) sequence entries, part 111. 888. gbgss112.seq - GSS (genome survey sequence) sequence entries, part 112. 889. gbgss113.seq - GSS (genome survey sequence) sequence entries, part 113. 890. gbgss114.seq - GSS (genome survey sequence) sequence entries, part 114. 891. gbgss115.seq - GSS (genome survey sequence) sequence entries, part 115. 892. gbgss116.seq - GSS (genome survey sequence) sequence entries, part 116. 893. gbgss117.seq - GSS (genome survey sequence) sequence entries, part 117. 894. gbgss118.seq - GSS (genome survey sequence) sequence entries, part 118. 895. gbgss119.seq - GSS (genome survey sequence) sequence entries, part 119. 896. gbgss12.seq - GSS (genome survey sequence) sequence entries, part 12. 897. gbgss120.seq - GSS (genome survey sequence) sequence entries, part 120. 898. gbgss121.seq - GSS (genome survey sequence) sequence entries, part 121. 899. gbgss122.seq - GSS (genome survey sequence) sequence entries, part 122. 900. gbgss13.seq - GSS (genome survey sequence) sequence entries, part 13. 901. gbgss14.seq - GSS (genome survey sequence) sequence entries, part 14. 902. gbgss15.seq - GSS (genome survey sequence) sequence entries, part 15. 903. gbgss16.seq - GSS (genome survey sequence) sequence entries, part 16. 904. gbgss17.seq - GSS (genome survey sequence) sequence entries, part 17. 905. gbgss18.seq - GSS (genome survey sequence) sequence entries, part 18. 906. gbgss19.seq - GSS (genome survey sequence) sequence entries, part 19. 907. gbgss2.seq - GSS (genome survey sequence) sequence entries, part 2. 908. gbgss20.seq - GSS (genome survey sequence) sequence entries, part 20. 909. gbgss21.seq - GSS (genome survey sequence) sequence entries, part 21. 910. gbgss22.seq - GSS (genome survey sequence) sequence entries, part 22. 911. gbgss23.seq - GSS (genome survey sequence) sequence entries, part 23. 912. gbgss24.seq - GSS (genome survey sequence) sequence entries, part 24. 913. gbgss25.seq - GSS (genome survey sequence) sequence entries, part 25. 914. gbgss26.seq - GSS (genome survey sequence) sequence entries, part 26. 915. gbgss27.seq - GSS (genome survey sequence) sequence entries, part 27. 916. gbgss28.seq - GSS (genome survey sequence) sequence entries, part 28. 917. gbgss29.seq - GSS (genome survey sequence) sequence entries, part 29. 918. gbgss3.seq - GSS (genome survey sequence) sequence entries, part 3. 919. gbgss30.seq - GSS (genome survey sequence) sequence entries, part 30. 920. gbgss31.seq - GSS (genome survey sequence) sequence entries, part 31. 921. gbgss32.seq - GSS (genome survey sequence) sequence entries, part 32. 922. gbgss33.seq - GSS (genome survey sequence) sequence entries, part 33. 923. gbgss34.seq - GSS (genome survey sequence) sequence entries, part 34. 924. gbgss35.seq - GSS (genome survey sequence) sequence entries, part 35. 925. gbgss36.seq - GSS (genome survey sequence) sequence entries, part 36. 926. gbgss37.seq - GSS (genome survey sequence) sequence entries, part 37. 927. gbgss38.seq - GSS (genome survey sequence) sequence entries, part 38. 928. gbgss39.seq - GSS (genome survey sequence) sequence entries, part 39. 929. gbgss4.seq - GSS (genome survey sequence) sequence entries, part 4. 930. gbgss40.seq - GSS (genome survey sequence) sequence entries, part 40. 931. gbgss41.seq - GSS (genome survey sequence) sequence entries, part 41. 932. gbgss42.seq - GSS (genome survey sequence) sequence entries, part 42. 933. gbgss43.seq - GSS (genome survey sequence) sequence entries, part 43. 934. gbgss44.seq - GSS (genome survey sequence) sequence entries, part 44. 935. gbgss45.seq - GSS (genome survey sequence) sequence entries, part 45. 936. gbgss46.seq - GSS (genome survey sequence) sequence entries, part 46. 937. gbgss47.seq - GSS (genome survey sequence) sequence entries, part 47. 938. gbgss48.seq - GSS (genome survey sequence) sequence entries, part 48. 939. gbgss49.seq - GSS (genome survey sequence) sequence entries, part 49. 940. gbgss5.seq - GSS (genome survey sequence) sequence entries, part 5. 941. gbgss50.seq - GSS (genome survey sequence) sequence entries, part 50. 942. gbgss51.seq - GSS (genome survey sequence) sequence entries, part 51. 943. gbgss52.seq - GSS (genome survey sequence) sequence entries, part 52. 944. gbgss53.seq - GSS (genome survey sequence) sequence entries, part 53. 945. gbgss54.seq - GSS (genome survey sequence) sequence entries, part 54. 946. gbgss55.seq - GSS (genome survey sequence) sequence entries, part 55. 947. gbgss56.seq - GSS (genome survey sequence) sequence entries, part 56. 948. gbgss57.seq - GSS (genome survey sequence) sequence entries, part 57. 949. gbgss58.seq - GSS (genome survey sequence) sequence entries, part 58. 950. gbgss59.seq - GSS (genome survey sequence) sequence entries, part 59. 951. gbgss6.seq - GSS (genome survey sequence) sequence entries, part 6. 952. gbgss60.seq - GSS (genome survey sequence) sequence entries, part 60. 953. gbgss61.seq - GSS (genome survey sequence) sequence entries, part 61. 954. gbgss62.seq - GSS (genome survey sequence) sequence entries, part 62. 955. gbgss63.seq - GSS (genome survey sequence) sequence entries, part 63. 956. gbgss64.seq - GSS (genome survey sequence) sequence entries, part 64. 957. gbgss65.seq - GSS (genome survey sequence) sequence entries, part 65. 958. gbgss66.seq - GSS (genome survey sequence) sequence entries, part 66. 959. gbgss67.seq - GSS (genome survey sequence) sequence entries, part 67. 960. gbgss68.seq - GSS (genome survey sequence) sequence entries, part 68. 961. gbgss69.seq - GSS (genome survey sequence) sequence entries, part 69. 962. gbgss7.seq - GSS (genome survey sequence) sequence entries, part 7. 963. gbgss70.seq - GSS (genome survey sequence) sequence entries, part 70. 964. gbgss71.seq - GSS (genome survey sequence) sequence entries, part 71. 965. gbgss72.seq - GSS (genome survey sequence) sequence entries, part 72. 966. gbgss73.seq - GSS (genome survey sequence) sequence entries, part 73. 967. gbgss74.seq - GSS (genome survey sequence) sequence entries, part 74. 968. gbgss75.seq - GSS (genome survey sequence) sequence entries, part 75. 969. gbgss76.seq - GSS (genome survey sequence) sequence entries, part 76. 970. gbgss77.seq - GSS (genome survey sequence) sequence entries, part 77. 971. gbgss78.seq - GSS (genome survey sequence) sequence entries, part 78. 972. gbgss79.seq - GSS (genome survey sequence) sequence entries, part 79. 973. gbgss8.seq - GSS (genome survey sequence) sequence entries, part 8. 974. gbgss80.seq - GSS (genome survey sequence) sequence entries, part 80. 975. gbgss81.seq - GSS (genome survey sequence) sequence entries, part 81. 976. gbgss82.seq - GSS (genome survey sequence) sequence entries, part 82. 977. gbgss83.seq - GSS (genome survey sequence) sequence entries, part 83. 978. gbgss84.seq - GSS (genome survey sequence) sequence entries, part 84. 979. gbgss85.seq - GSS (genome survey sequence) sequence entries, part 85. 980. gbgss86.seq - GSS (genome survey sequence) sequence entries, part 86. 981. gbgss87.seq - GSS (genome survey sequence) sequence entries, part 87. 982. gbgss88.seq - GSS (genome survey sequence) sequence entries, part 88. 983. gbgss89.seq - GSS (genome survey sequence) sequence entries, part 89. 984. gbgss9.seq - GSS (genome survey sequence) sequence entries, part 9. 985. gbgss90.seq - GSS (genome survey sequence) sequence entries, part 90. 986. gbgss91.seq - GSS (genome survey sequence) sequence entries, part 91. 987. gbgss92.seq - GSS (genome survey sequence) sequence entries, part 92. 988. gbgss93.seq - GSS (genome survey sequence) sequence entries, part 93. 989. gbgss94.seq - GSS (genome survey sequence) sequence entries, part 94. 990. gbgss95.seq - GSS (genome survey sequence) sequence entries, part 95. 991. gbgss96.seq - GSS (genome survey sequence) sequence entries, part 96. 992. gbgss97.seq - GSS (genome survey sequence) sequence entries, part 97. 993. gbgss98.seq - GSS (genome survey sequence) sequence entries, part 98. 994. gbgss99.seq - GSS (genome survey sequence) sequence entries, part 99. 995. gbhtc1.seq - HTC (high throughput cDNA sequencing) sequence entries, part 1. 996. gbhtc2.seq - HTC (high throughput cDNA sequencing) sequence entries, part 2. 997. gbhtc3.seq - HTC (high throughput cDNA sequencing) sequence entries, part 3. 998. gbhtc4.seq - HTC (high throughput cDNA sequencing) sequence entries, part 4. 999. gbhtg1.seq - HTGS (high throughput genomic sequencing) sequence entries, part 1. 1000. gbhtg10.seq - HTGS (high throughput genomic sequencing) sequence entries, part 10. 1001. gbhtg11.seq - HTGS (high throughput genomic sequencing) sequence entries, part 11. 1002. gbhtg12.seq - HTGS (high throughput genomic sequencing) sequence entries, part 12. 1003. gbhtg13.seq - HTGS (high throughput genomic sequencing) sequence entries, part 13. 1004. gbhtg14.seq - HTGS (high throughput genomic sequencing) sequence entries, part 14. 1005. gbhtg15.seq - HTGS (high throughput genomic sequencing) sequence entries, part 15. 1006. gbhtg16.seq - HTGS (high throughput genomic sequencing) sequence entries, part 16. 1007. gbhtg17.seq - HTGS (high throughput genomic sequencing) sequence entries, part 17. 1008. gbhtg18.seq - HTGS (high throughput genomic sequencing) sequence entries, part 18. 1009. gbhtg19.seq - HTGS (high throughput genomic sequencing) sequence entries, part 19. 1010. gbhtg2.seq - HTGS (high throughput genomic sequencing) sequence entries, part 2. 1011. gbhtg20.seq - HTGS (high throughput genomic sequencing) sequence entries, part 20. 1012. gbhtg21.seq - HTGS (high throughput genomic sequencing) sequence entries, part 21. 1013. gbhtg22.seq - HTGS (high throughput genomic sequencing) sequence entries, part 22. 1014. gbhtg23.seq - HTGS (high throughput genomic sequencing) sequence entries, part 23. 1015. gbhtg24.seq - HTGS (high throughput genomic sequencing) sequence entries, part 24. 1016. gbhtg25.seq - HTGS (high throughput genomic sequencing) sequence entries, part 25. 1017. gbhtg26.seq - HTGS (high throughput genomic sequencing) sequence entries, part 26. 1018. gbhtg27.seq - HTGS (high throughput genomic sequencing) sequence entries, part 27. 1019. gbhtg28.seq - HTGS (high throughput genomic sequencing) sequence entries, part 28. 1020. gbhtg29.seq - HTGS (high throughput genomic sequencing) sequence entries, part 29. 1021. gbhtg3.seq - HTGS (high throughput genomic sequencing) sequence entries, part 3. 1022. gbhtg30.seq - HTGS (high throughput genomic sequencing) sequence entries, part 30. 1023. gbhtg4.seq - HTGS (high throughput genomic sequencing) sequence entries, part 4. 1024. gbhtg5.seq - HTGS (high throughput genomic sequencing) sequence entries, part 5. 1025. gbhtg6.seq - HTGS (high throughput genomic sequencing) sequence entries, part 6. 1026. gbhtg7.seq - HTGS (high throughput genomic sequencing) sequence entries, part 7. 1027. gbhtg8.seq - HTGS (high throughput genomic sequencing) sequence entries, part 8. 1028. gbhtg9.seq - HTGS (high throughput genomic sequencing) sequence entries, part 9. 1029. gbinv1.seq - Invertebrate sequence entries, part 1. 1030. gbinv10.seq - Invertebrate sequence entries, part 10. 1031. gbinv100.seq - Invertebrate sequence entries, part 100. 1032. gbinv1000.seq - Invertebrate sequence entries, part 1000. 1033. gbinv1001.seq - Invertebrate sequence entries, part 1001. 1034. gbinv1002.seq - Invertebrate sequence entries, part 1002. 1035. gbinv1003.seq - Invertebrate sequence entries, part 1003. 1036. gbinv1004.seq - Invertebrate sequence entries, part 1004. 1037. gbinv1005.seq - Invertebrate sequence entries, part 1005. 1038. gbinv1006.seq - Invertebrate sequence entries, part 1006. 1039. gbinv1007.seq - Invertebrate sequence entries, part 1007. 1040. gbinv1008.seq - Invertebrate sequence entries, part 1008. 1041. gbinv1009.seq - Invertebrate sequence entries, part 1009. 1042. gbinv101.seq - Invertebrate sequence entries, part 101. 1043. gbinv1010.seq - Invertebrate sequence entries, part 1010. 1044. gbinv1011.seq - Invertebrate sequence entries, part 1011. 1045. gbinv1012.seq - Invertebrate sequence entries, part 1012. 1046. gbinv1013.seq - Invertebrate sequence entries, part 1013. 1047. gbinv1014.seq - Invertebrate sequence entries, part 1014. 1048. gbinv1015.seq - Invertebrate sequence entries, part 1015. 1049. gbinv1016.seq - Invertebrate sequence entries, part 1016. 1050. gbinv1017.seq - Invertebrate sequence entries, part 1017. 1051. gbinv1018.seq - Invertebrate sequence entries, part 1018. 1052. gbinv1019.seq - Invertebrate sequence entries, part 1019. 1053. gbinv102.seq - Invertebrate sequence entries, part 102. 1054. gbinv1020.seq - Invertebrate sequence entries, part 1020. 1055. gbinv1021.seq - Invertebrate sequence entries, part 1021. 1056. gbinv1022.seq - Invertebrate sequence entries, part 1022. 1057. gbinv1023.seq - Invertebrate sequence entries, part 1023. 1058. gbinv1024.seq - Invertebrate sequence entries, part 1024. 1059. gbinv1025.seq - Invertebrate sequence entries, part 1025. 1060. gbinv1026.seq - Invertebrate sequence entries, part 1026. 1061. gbinv1027.seq - Invertebrate sequence entries, part 1027. 1062. gbinv1028.seq - Invertebrate sequence entries, part 1028. 1063. gbinv1029.seq - Invertebrate sequence entries, part 1029. 1064. gbinv103.seq - Invertebrate sequence entries, part 103. 1065. gbinv1030.seq - Invertebrate sequence entries, part 1030. 1066. gbinv1031.seq - Invertebrate sequence entries, part 1031. 1067. gbinv1032.seq - Invertebrate sequence entries, part 1032. 1068. gbinv1033.seq - Invertebrate sequence entries, part 1033. 1069. gbinv1034.seq - Invertebrate sequence entries, part 1034. 1070. gbinv1035.seq - Invertebrate sequence entries, part 1035. 1071. gbinv1036.seq - Invertebrate sequence entries, part 1036. 1072. gbinv1037.seq - Invertebrate sequence entries, part 1037. 1073. gbinv1038.seq - Invertebrate sequence entries, part 1038. 1074. gbinv1039.seq - Invertebrate sequence entries, part 1039. 1075. gbinv104.seq - Invertebrate sequence entries, part 104. 1076. gbinv1040.seq - Invertebrate sequence entries, part 1040. 1077. gbinv1041.seq - Invertebrate sequence entries, part 1041. 1078. gbinv1042.seq - Invertebrate sequence entries, part 1042. 1079. gbinv1043.seq - Invertebrate sequence entries, part 1043. 1080. gbinv1044.seq - Invertebrate sequence entries, part 1044. 1081. gbinv1045.seq - Invertebrate sequence entries, part 1045. 1082. gbinv1046.seq - Invertebrate sequence entries, part 1046. 1083. gbinv1047.seq - Invertebrate sequence entries, part 1047. 1084. gbinv1048.seq - Invertebrate sequence entries, part 1048. 1085. gbinv1049.seq - Invertebrate sequence entries, part 1049. 1086. gbinv105.seq - Invertebrate sequence entries, part 105. 1087. gbinv1050.seq - Invertebrate sequence entries, part 1050. 1088. gbinv1051.seq - Invertebrate sequence entries, part 1051. 1089. gbinv1052.seq - Invertebrate sequence entries, part 1052. 1090. gbinv1053.seq - Invertebrate sequence entries, part 1053. 1091. gbinv1054.seq - Invertebrate sequence entries, part 1054. 1092. gbinv1055.seq - Invertebrate sequence entries, part 1055. 1093. gbinv1056.seq - Invertebrate sequence entries, part 1056. 1094. gbinv1057.seq - Invertebrate sequence entries, part 1057. 1095. gbinv1058.seq - Invertebrate sequence entries, part 1058. 1096. gbinv1059.seq - Invertebrate sequence entries, part 1059. 1097. gbinv106.seq - Invertebrate sequence entries, part 106. 1098. gbinv1060.seq - Invertebrate sequence entries, part 1060. 1099. gbinv1061.seq - Invertebrate sequence entries, part 1061. 1100. gbinv1062.seq - Invertebrate sequence entries, part 1062. 1101. gbinv1063.seq - Invertebrate sequence entries, part 1063. 1102. gbinv1064.seq - Invertebrate sequence entries, part 1064. 1103. gbinv1065.seq - Invertebrate sequence entries, part 1065. 1104. gbinv1066.seq - Invertebrate sequence entries, part 1066. 1105. gbinv1067.seq - Invertebrate sequence entries, part 1067. 1106. gbinv1068.seq - Invertebrate sequence entries, part 1068. 1107. gbinv1069.seq - Invertebrate sequence entries, part 1069. 1108. gbinv107.seq - Invertebrate sequence entries, part 107. 1109. gbinv1070.seq - Invertebrate sequence entries, part 1070. 1110. gbinv1071.seq - Invertebrate sequence entries, part 1071. 1111. gbinv1072.seq - Invertebrate sequence entries, part 1072. 1112. gbinv1073.seq - Invertebrate sequence entries, part 1073. 1113. gbinv1074.seq - Invertebrate sequence entries, part 1074. 1114. gbinv1075.seq - Invertebrate sequence entries, part 1075. 1115. gbinv1076.seq - Invertebrate sequence entries, part 1076. 1116. gbinv1077.seq - Invertebrate sequence entries, part 1077. 1117. gbinv108.seq - Invertebrate sequence entries, part 108. 1118. gbinv109.seq - Invertebrate sequence entries, part 109. 1119. gbinv11.seq - Invertebrate sequence entries, part 11. 1120. gbinv110.seq - Invertebrate sequence entries, part 110. 1121. gbinv111.seq - Invertebrate sequence entries, part 111. 1122. gbinv112.seq - Invertebrate sequence entries, part 112. 1123. gbinv113.seq - Invertebrate sequence entries, part 113. 1124. gbinv114.seq - Invertebrate sequence entries, part 114. 1125. gbinv115.seq - Invertebrate sequence entries, part 115. 1126. gbinv116.seq - Invertebrate sequence entries, part 116. 1127. gbinv117.seq - Invertebrate sequence entries, part 117. 1128. gbinv118.seq - Invertebrate sequence entries, part 118. 1129. gbinv119.seq - Invertebrate sequence entries, part 119. 1130. gbinv12.seq - Invertebrate sequence entries, part 12. 1131. gbinv120.seq - Invertebrate sequence entries, part 120. 1132. gbinv121.seq - Invertebrate sequence entries, part 121. 1133. gbinv122.seq - Invertebrate sequence entries, part 122. 1134. gbinv123.seq - Invertebrate sequence entries, part 123. 1135. gbinv124.seq - Invertebrate sequence entries, part 124. 1136. gbinv125.seq - Invertebrate sequence entries, part 125. 1137. gbinv126.seq - Invertebrate sequence entries, part 126. 1138. gbinv127.seq - Invertebrate sequence entries, part 127. 1139. gbinv128.seq - Invertebrate sequence entries, part 128. 1140. gbinv129.seq - Invertebrate sequence entries, part 129. 1141. gbinv13.seq - Invertebrate sequence entries, part 13. 1142. gbinv130.seq - Invertebrate sequence entries, part 130. 1143. gbinv131.seq - Invertebrate sequence entries, part 131. 1144. gbinv132.seq - Invertebrate sequence entries, part 132. 1145. gbinv133.seq - Invertebrate sequence entries, part 133. 1146. gbinv134.seq - Invertebrate sequence entries, part 134. 1147. gbinv135.seq - Invertebrate sequence entries, part 135. 1148. gbinv136.seq - Invertebrate sequence entries, part 136. 1149. gbinv137.seq - Invertebrate sequence entries, part 137. 1150. gbinv138.seq - Invertebrate sequence entries, part 138. 1151. gbinv139.seq - Invertebrate sequence entries, part 139. 1152. gbinv14.seq - Invertebrate sequence entries, part 14. 1153. gbinv140.seq - Invertebrate sequence entries, part 140. 1154. gbinv141.seq - Invertebrate sequence entries, part 141. 1155. gbinv142.seq - Invertebrate sequence entries, part 142. 1156. gbinv143.seq - Invertebrate sequence entries, part 143. 1157. gbinv144.seq - Invertebrate sequence entries, part 144. 1158. gbinv145.seq - Invertebrate sequence entries, part 145. 1159. gbinv146.seq - Invertebrate sequence entries, part 146. 1160. gbinv147.seq - Invertebrate sequence entries, part 147. 1161. gbinv148.seq - Invertebrate sequence entries, part 148. 1162. gbinv149.seq - Invertebrate sequence entries, part 149. 1163. gbinv15.seq - Invertebrate sequence entries, part 15. 1164. gbinv150.seq - Invertebrate sequence entries, part 150. 1165. gbinv151.seq - Invertebrate sequence entries, part 151. 1166. gbinv152.seq - Invertebrate sequence entries, part 152. 1167. gbinv153.seq - Invertebrate sequence entries, part 153. 1168. gbinv154.seq - Invertebrate sequence entries, part 154. 1169. gbinv155.seq - Invertebrate sequence entries, part 155. 1170. gbinv156.seq - Invertebrate sequence entries, part 156. 1171. gbinv157.seq - Invertebrate sequence entries, part 157. 1172. gbinv158.seq - Invertebrate sequence entries, part 158. 1173. gbinv159.seq - Invertebrate sequence entries, part 159. 1174. gbinv16.seq - Invertebrate sequence entries, part 16. 1175. gbinv160.seq - Invertebrate sequence entries, part 160. 1176. gbinv161.seq - Invertebrate sequence entries, part 161. 1177. gbinv162.seq - Invertebrate sequence entries, part 162. 1178. gbinv163.seq - Invertebrate sequence entries, part 163. 1179. gbinv164.seq - Invertebrate sequence entries, part 164. 1180. gbinv165.seq - Invertebrate sequence entries, part 165. 1181. gbinv166.seq - Invertebrate sequence entries, part 166. 1182. gbinv167.seq - Invertebrate sequence entries, part 167. 1183. gbinv168.seq - Invertebrate sequence entries, part 168. 1184. gbinv169.seq - Invertebrate sequence entries, part 169. 1185. gbinv17.seq - Invertebrate sequence entries, part 17. 1186. gbinv170.seq - Invertebrate sequence entries, part 170. 1187. gbinv171.seq - Invertebrate sequence entries, part 171. 1188. gbinv172.seq - Invertebrate sequence entries, part 172. 1189. gbinv173.seq - Invertebrate sequence entries, part 173. 1190. gbinv174.seq - Invertebrate sequence entries, part 174. 1191. gbinv175.seq - Invertebrate sequence entries, part 175. 1192. gbinv176.seq - Invertebrate sequence entries, part 176. 1193. gbinv177.seq - Invertebrate sequence entries, part 177. 1194. gbinv178.seq - Invertebrate sequence entries, part 178. 1195. gbinv179.seq - Invertebrate sequence entries, part 179. 1196. gbinv18.seq - Invertebrate sequence entries, part 18. 1197. gbinv180.seq - Invertebrate sequence entries, part 180. 1198. gbinv181.seq - Invertebrate sequence entries, part 181. 1199. gbinv182.seq - Invertebrate sequence entries, part 182. 1200. gbinv183.seq - Invertebrate sequence entries, part 183. 1201. gbinv184.seq - Invertebrate sequence entries, part 184. 1202. gbinv185.seq - Invertebrate sequence entries, part 185. 1203. gbinv186.seq - Invertebrate sequence entries, part 186. 1204. gbinv187.seq - Invertebrate sequence entries, part 187. 1205. gbinv188.seq - Invertebrate sequence entries, part 188. 1206. gbinv189.seq - Invertebrate sequence entries, part 189. 1207. gbinv19.seq - Invertebrate sequence entries, part 19. 1208. gbinv190.seq - Invertebrate sequence entries, part 190. 1209. gbinv191.seq - Invertebrate sequence entries, part 191. 1210. gbinv192.seq - Invertebrate sequence entries, part 192. 1211. gbinv193.seq - Invertebrate sequence entries, part 193. 1212. gbinv194.seq - Invertebrate sequence entries, part 194. 1213. gbinv195.seq - Invertebrate sequence entries, part 195. 1214. gbinv196.seq - Invertebrate sequence entries, part 196. 1215. gbinv197.seq - Invertebrate sequence entries, part 197. 1216. gbinv198.seq - Invertebrate sequence entries, part 198. 1217. gbinv199.seq - Invertebrate sequence entries, part 199. 1218. gbinv2.seq - Invertebrate sequence entries, part 2. 1219. gbinv20.seq - Invertebrate sequence entries, part 20. 1220. gbinv200.seq - Invertebrate sequence entries, part 200. 1221. gbinv201.seq - Invertebrate sequence entries, part 201. 1222. gbinv202.seq - Invertebrate sequence entries, part 202. 1223. gbinv203.seq - Invertebrate sequence entries, part 203. 1224. gbinv204.seq - Invertebrate sequence entries, part 204. 1225. gbinv205.seq - Invertebrate sequence entries, part 205. 1226. gbinv206.seq - Invertebrate sequence entries, part 206. 1227. gbinv207.seq - Invertebrate sequence entries, part 207. 1228. gbinv208.seq - Invertebrate sequence entries, part 208. 1229. gbinv209.seq - Invertebrate sequence entries, part 209. 1230. gbinv21.seq - Invertebrate sequence entries, part 21. 1231. gbinv210.seq - Invertebrate sequence entries, part 210. 1232. gbinv211.seq - Invertebrate sequence entries, part 211. 1233. gbinv212.seq - Invertebrate sequence entries, part 212. 1234. gbinv213.seq - Invertebrate sequence entries, part 213. 1235. gbinv214.seq - Invertebrate sequence entries, part 214. 1236. gbinv215.seq - Invertebrate sequence entries, part 215. 1237. gbinv216.seq - Invertebrate sequence entries, part 216. 1238. gbinv217.seq - Invertebrate sequence entries, part 217. 1239. gbinv218.seq - Invertebrate sequence entries, part 218. 1240. gbinv219.seq - Invertebrate sequence entries, part 219. 1241. gbinv22.seq - Invertebrate sequence entries, part 22. 1242. gbinv220.seq - Invertebrate sequence entries, part 220. 1243. gbinv221.seq - Invertebrate sequence entries, part 221. 1244. gbinv222.seq - Invertebrate sequence entries, part 222. 1245. gbinv223.seq - Invertebrate sequence entries, part 223. 1246. gbinv224.seq - Invertebrate sequence entries, part 224. 1247. gbinv225.seq - Invertebrate sequence entries, part 225. 1248. gbinv226.seq - Invertebrate sequence entries, part 226. 1249. gbinv227.seq - Invertebrate sequence entries, part 227. 1250. gbinv228.seq - Invertebrate sequence entries, part 228. 1251. gbinv229.seq - Invertebrate sequence entries, part 229. 1252. gbinv23.seq - Invertebrate sequence entries, part 23. 1253. gbinv230.seq - Invertebrate sequence entries, part 230. 1254. gbinv231.seq - Invertebrate sequence entries, part 231. 1255. gbinv232.seq - Invertebrate sequence entries, part 232. 1256. gbinv233.seq - Invertebrate sequence entries, part 233. 1257. gbinv234.seq - Invertebrate sequence entries, part 234. 1258. gbinv235.seq - Invertebrate sequence entries, part 235. 1259. gbinv236.seq - Invertebrate sequence entries, part 236. 1260. gbinv237.seq - Invertebrate sequence entries, part 237. 1261. gbinv238.seq - Invertebrate sequence entries, part 238. 1262. gbinv239.seq - Invertebrate sequence entries, part 239. 1263. gbinv24.seq - Invertebrate sequence entries, part 24. 1264. gbinv240.seq - Invertebrate sequence entries, part 240. 1265. gbinv241.seq - Invertebrate sequence entries, part 241. 1266. gbinv242.seq - Invertebrate sequence entries, part 242. 1267. gbinv243.seq - Invertebrate sequence entries, part 243. 1268. gbinv244.seq - Invertebrate sequence entries, part 244. 1269. gbinv245.seq - Invertebrate sequence entries, part 245. 1270. gbinv246.seq - Invertebrate sequence entries, part 246. 1271. gbinv247.seq - Invertebrate sequence entries, part 247. 1272. gbinv248.seq - Invertebrate sequence entries, part 248. 1273. gbinv249.seq - Invertebrate sequence entries, part 249. 1274. gbinv25.seq - Invertebrate sequence entries, part 25. 1275. gbinv250.seq - Invertebrate sequence entries, part 250. 1276. gbinv251.seq - Invertebrate sequence entries, part 251. 1277. gbinv252.seq - Invertebrate sequence entries, part 252. 1278. gbinv253.seq - Invertebrate sequence entries, part 253. 1279. gbinv254.seq - Invertebrate sequence entries, part 254. 1280. gbinv255.seq - Invertebrate sequence entries, part 255. 1281. gbinv256.seq - Invertebrate sequence entries, part 256. 1282. gbinv257.seq - Invertebrate sequence entries, part 257. 1283. gbinv258.seq - Invertebrate sequence entries, part 258. 1284. gbinv259.seq - Invertebrate sequence entries, part 259. 1285. gbinv26.seq - Invertebrate sequence entries, part 26. 1286. gbinv260.seq - Invertebrate sequence entries, part 260. 1287. gbinv261.seq - Invertebrate sequence entries, part 261. 1288. gbinv262.seq - Invertebrate sequence entries, part 262. 1289. gbinv263.seq - Invertebrate sequence entries, part 263. 1290. gbinv264.seq - Invertebrate sequence entries, part 264. 1291. gbinv265.seq - Invertebrate sequence entries, part 265. 1292. gbinv266.seq - Invertebrate sequence entries, part 266. 1293. gbinv267.seq - Invertebrate sequence entries, part 267. 1294. gbinv268.seq - Invertebrate sequence entries, part 268. 1295. gbinv269.seq - Invertebrate sequence entries, part 269. 1296. gbinv27.seq - Invertebrate sequence entries, part 27. 1297. gbinv270.seq - Invertebrate sequence entries, part 270. 1298. gbinv271.seq - Invertebrate sequence entries, part 271. 1299. gbinv272.seq - Invertebrate sequence entries, part 272. 1300. gbinv273.seq - Invertebrate sequence entries, part 273. 1301. gbinv274.seq - Invertebrate sequence entries, part 274. 1302. gbinv275.seq - Invertebrate sequence entries, part 275. 1303. gbinv276.seq - Invertebrate sequence entries, part 276. 1304. gbinv277.seq - Invertebrate sequence entries, part 277. 1305. gbinv278.seq - Invertebrate sequence entries, part 278. 1306. gbinv279.seq - Invertebrate sequence entries, part 279. 1307. gbinv28.seq - Invertebrate sequence entries, part 28. 1308. gbinv280.seq - Invertebrate sequence entries, part 280. 1309. gbinv281.seq - Invertebrate sequence entries, part 281. 1310. gbinv282.seq - Invertebrate sequence entries, part 282. 1311. gbinv283.seq - Invertebrate sequence entries, part 283. 1312. gbinv284.seq - Invertebrate sequence entries, part 284. 1313. gbinv285.seq - Invertebrate sequence entries, part 285. 1314. gbinv286.seq - Invertebrate sequence entries, part 286. 1315. gbinv287.seq - Invertebrate sequence entries, part 287. 1316. gbinv288.seq - Invertebrate sequence entries, part 288. 1317. gbinv289.seq - Invertebrate sequence entries, part 289. 1318. gbinv29.seq - Invertebrate sequence entries, part 29. 1319. gbinv290.seq - Invertebrate sequence entries, part 290. 1320. gbinv291.seq - Invertebrate sequence entries, part 291. 1321. gbinv292.seq - Invertebrate sequence entries, part 292. 1322. gbinv293.seq - Invertebrate sequence entries, part 293. 1323. gbinv294.seq - Invertebrate sequence entries, part 294. 1324. gbinv295.seq - Invertebrate sequence entries, part 295. 1325. gbinv296.seq - Invertebrate sequence entries, part 296. 1326. gbinv297.seq - Invertebrate sequence entries, part 297. 1327. gbinv298.seq - Invertebrate sequence entries, part 298. 1328. gbinv299.seq - Invertebrate sequence entries, part 299. 1329. gbinv3.seq - Invertebrate sequence entries, part 3. 1330. gbinv30.seq - Invertebrate sequence entries, part 30. 1331. gbinv300.seq - Invertebrate sequence entries, part 300. 1332. gbinv301.seq - Invertebrate sequence entries, part 301. 1333. gbinv302.seq - Invertebrate sequence entries, part 302. 1334. gbinv303.seq - Invertebrate sequence entries, part 303. 1335. gbinv304.seq - Invertebrate sequence entries, part 304. 1336. gbinv305.seq - Invertebrate sequence entries, part 305. 1337. gbinv306.seq - Invertebrate sequence entries, part 306. 1338. gbinv307.seq - Invertebrate sequence entries, part 307. 1339. gbinv308.seq - Invertebrate sequence entries, part 308. 1340. gbinv309.seq - Invertebrate sequence entries, part 309. 1341. gbinv31.seq - Invertebrate sequence entries, part 31. 1342. gbinv310.seq - Invertebrate sequence entries, part 310. 1343. gbinv311.seq - Invertebrate sequence entries, part 311. 1344. gbinv312.seq - Invertebrate sequence entries, part 312. 1345. gbinv313.seq - Invertebrate sequence entries, part 313. 1346. gbinv314.seq - Invertebrate sequence entries, part 314. 1347. gbinv315.seq - Invertebrate sequence entries, part 315. 1348. gbinv316.seq - Invertebrate sequence entries, part 316. 1349. gbinv317.seq - Invertebrate sequence entries, part 317. 1350. gbinv318.seq - Invertebrate sequence entries, part 318. 1351. gbinv319.seq - Invertebrate sequence entries, part 319. 1352. gbinv32.seq - Invertebrate sequence entries, part 32. 1353. gbinv320.seq - Invertebrate sequence entries, part 320. 1354. gbinv321.seq - Invertebrate sequence entries, part 321. 1355. gbinv322.seq - Invertebrate sequence entries, part 322. 1356. gbinv323.seq - Invertebrate sequence entries, part 323. 1357. gbinv324.seq - Invertebrate sequence entries, part 324. 1358. gbinv325.seq - Invertebrate sequence entries, part 325. 1359. gbinv326.seq - Invertebrate sequence entries, part 326. 1360. gbinv327.seq - Invertebrate sequence entries, part 327. 1361. gbinv328.seq - Invertebrate sequence entries, part 328. 1362. gbinv329.seq - Invertebrate sequence entries, part 329. 1363. gbinv33.seq - Invertebrate sequence entries, part 33. 1364. gbinv330.seq - Invertebrate sequence entries, part 330. 1365. gbinv331.seq - Invertebrate sequence entries, part 331. 1366. gbinv332.seq - Invertebrate sequence entries, part 332. 1367. gbinv333.seq - Invertebrate sequence entries, part 333. 1368. gbinv334.seq - Invertebrate sequence entries, part 334. 1369. gbinv335.seq - Invertebrate sequence entries, part 335. 1370. gbinv336.seq - Invertebrate sequence entries, part 336. 1371. gbinv337.seq - Invertebrate sequence entries, part 337. 1372. gbinv338.seq - Invertebrate sequence entries, part 338. 1373. gbinv339.seq - Invertebrate sequence entries, part 339. 1374. gbinv34.seq - Invertebrate sequence entries, part 34. 1375. gbinv340.seq - Invertebrate sequence entries, part 340. 1376. gbinv341.seq - Invertebrate sequence entries, part 341. 1377. gbinv342.seq - Invertebrate sequence entries, part 342. 1378. gbinv343.seq - Invertebrate sequence entries, part 343. 1379. gbinv344.seq - Invertebrate sequence entries, part 344. 1380. gbinv345.seq - Invertebrate sequence entries, part 345. 1381. gbinv346.seq - Invertebrate sequence entries, part 346. 1382. gbinv347.seq - Invertebrate sequence entries, part 347. 1383. gbinv348.seq - Invertebrate sequence entries, part 348. 1384. gbinv349.seq - Invertebrate sequence entries, part 349. 1385. gbinv35.seq - Invertebrate sequence entries, part 35. 1386. gbinv350.seq - Invertebrate sequence entries, part 350. 1387. gbinv351.seq - Invertebrate sequence entries, part 351. 1388. gbinv352.seq - Invertebrate sequence entries, part 352. 1389. gbinv353.seq - Invertebrate sequence entries, part 353. 1390. gbinv354.seq - Invertebrate sequence entries, part 354. 1391. gbinv355.seq - Invertebrate sequence entries, part 355. 1392. gbinv356.seq - Invertebrate sequence entries, part 356. 1393. gbinv357.seq - Invertebrate sequence entries, part 357. 1394. gbinv358.seq - Invertebrate sequence entries, part 358. 1395. gbinv359.seq - Invertebrate sequence entries, part 359. 1396. gbinv36.seq - Invertebrate sequence entries, part 36. 1397. gbinv360.seq - Invertebrate sequence entries, part 360. 1398. gbinv361.seq - Invertebrate sequence entries, part 361. 1399. gbinv362.seq - Invertebrate sequence entries, part 362. 1400. gbinv363.seq - Invertebrate sequence entries, part 363. 1401. gbinv364.seq - Invertebrate sequence entries, part 364. 1402. gbinv365.seq - Invertebrate sequence entries, part 365. 1403. gbinv366.seq - Invertebrate sequence entries, part 366. 1404. gbinv367.seq - Invertebrate sequence entries, part 367. 1405. gbinv368.seq - Invertebrate sequence entries, part 368. 1406. gbinv369.seq - Invertebrate sequence entries, part 369. 1407. gbinv37.seq - Invertebrate sequence entries, part 37. 1408. gbinv370.seq - Invertebrate sequence entries, part 370. 1409. gbinv371.seq - Invertebrate sequence entries, part 371. 1410. gbinv372.seq - Invertebrate sequence entries, part 372. 1411. gbinv373.seq - Invertebrate sequence entries, part 373. 1412. gbinv374.seq - Invertebrate sequence entries, part 374. 1413. gbinv375.seq - Invertebrate sequence entries, part 375. 1414. gbinv376.seq - Invertebrate sequence entries, part 376. 1415. gbinv377.seq - Invertebrate sequence entries, part 377. 1416. gbinv378.seq - Invertebrate sequence entries, part 378. 1417. gbinv379.seq - Invertebrate sequence entries, part 379. 1418. gbinv38.seq - Invertebrate sequence entries, part 38. 1419. gbinv380.seq - Invertebrate sequence entries, part 380. 1420. gbinv381.seq - Invertebrate sequence entries, part 381. 1421. gbinv382.seq - Invertebrate sequence entries, part 382. 1422. gbinv383.seq - Invertebrate sequence entries, part 383. 1423. gbinv384.seq - Invertebrate sequence entries, part 384. 1424. gbinv385.seq - Invertebrate sequence entries, part 385. 1425. gbinv386.seq - Invertebrate sequence entries, part 386. 1426. gbinv387.seq - Invertebrate sequence entries, part 387. 1427. gbinv388.seq - Invertebrate sequence entries, part 388. 1428. gbinv389.seq - Invertebrate sequence entries, part 389. 1429. gbinv39.seq - Invertebrate sequence entries, part 39. 1430. gbinv390.seq - Invertebrate sequence entries, part 390. 1431. gbinv391.seq - Invertebrate sequence entries, part 391. 1432. gbinv392.seq - Invertebrate sequence entries, part 392. 1433. gbinv393.seq - Invertebrate sequence entries, part 393. 1434. gbinv394.seq - Invertebrate sequence entries, part 394. 1435. gbinv395.seq - Invertebrate sequence entries, part 395. 1436. gbinv396.seq - Invertebrate sequence entries, part 396. 1437. gbinv397.seq - Invertebrate sequence entries, part 397. 1438. gbinv398.seq - Invertebrate sequence entries, part 398. 1439. gbinv399.seq - Invertebrate sequence entries, part 399. 1440. gbinv4.seq - Invertebrate sequence entries, part 4. 1441. gbinv40.seq - Invertebrate sequence entries, part 40. 1442. gbinv400.seq - Invertebrate sequence entries, part 400. 1443. gbinv401.seq - Invertebrate sequence entries, part 401. 1444. gbinv402.seq - Invertebrate sequence entries, part 402. 1445. gbinv403.seq - Invertebrate sequence entries, part 403. 1446. gbinv404.seq - Invertebrate sequence entries, part 404. 1447. gbinv405.seq - Invertebrate sequence entries, part 405. 1448. gbinv406.seq - Invertebrate sequence entries, part 406. 1449. gbinv407.seq - Invertebrate sequence entries, part 407. 1450. gbinv408.seq - Invertebrate sequence entries, part 408. 1451. gbinv409.seq - Invertebrate sequence entries, part 409. 1452. gbinv41.seq - Invertebrate sequence entries, part 41. 1453. gbinv410.seq - Invertebrate sequence entries, part 410. 1454. gbinv411.seq - Invertebrate sequence entries, part 411. 1455. gbinv412.seq - Invertebrate sequence entries, part 412. 1456. gbinv413.seq - Invertebrate sequence entries, part 413. 1457. gbinv414.seq - Invertebrate sequence entries, part 414. 1458. gbinv415.seq - Invertebrate sequence entries, part 415. 1459. gbinv416.seq - Invertebrate sequence entries, part 416. 1460. gbinv417.seq - Invertebrate sequence entries, part 417. 1461. gbinv418.seq - Invertebrate sequence entries, part 418. 1462. gbinv419.seq - Invertebrate sequence entries, part 419. 1463. gbinv42.seq - Invertebrate sequence entries, part 42. 1464. gbinv420.seq - Invertebrate sequence entries, part 420. 1465. gbinv421.seq - Invertebrate sequence entries, part 421. 1466. gbinv422.seq - Invertebrate sequence entries, part 422. 1467. gbinv423.seq - Invertebrate sequence entries, part 423. 1468. gbinv424.seq - Invertebrate sequence entries, part 424. 1469. gbinv425.seq - Invertebrate sequence entries, part 425. 1470. gbinv426.seq - Invertebrate sequence entries, part 426. 1471. gbinv427.seq - Invertebrate sequence entries, part 427. 1472. gbinv428.seq - Invertebrate sequence entries, part 428. 1473. gbinv429.seq - Invertebrate sequence entries, part 429. 1474. gbinv43.seq - Invertebrate sequence entries, part 43. 1475. gbinv430.seq - Invertebrate sequence entries, part 430. 1476. gbinv431.seq - Invertebrate sequence entries, part 431. 1477. gbinv432.seq - Invertebrate sequence entries, part 432. 1478. gbinv433.seq - Invertebrate sequence entries, part 433. 1479. gbinv434.seq - Invertebrate sequence entries, part 434. 1480. gbinv435.seq - Invertebrate sequence entries, part 435. 1481. gbinv436.seq - Invertebrate sequence entries, part 436. 1482. gbinv437.seq - Invertebrate sequence entries, part 437. 1483. gbinv438.seq - Invertebrate sequence entries, part 438. 1484. gbinv439.seq - Invertebrate sequence entries, part 439. 1485. gbinv44.seq - Invertebrate sequence entries, part 44. 1486. gbinv440.seq - Invertebrate sequence entries, part 440. 1487. gbinv441.seq - Invertebrate sequence entries, part 441. 1488. gbinv442.seq - Invertebrate sequence entries, part 442. 1489. gbinv443.seq - Invertebrate sequence entries, part 443. 1490. gbinv444.seq - Invertebrate sequence entries, part 444. 1491. gbinv445.seq - Invertebrate sequence entries, part 445. 1492. gbinv446.seq - Invertebrate sequence entries, part 446. 1493. gbinv447.seq - Invertebrate sequence entries, part 447. 1494. gbinv448.seq - Invertebrate sequence entries, part 448. 1495. gbinv449.seq - Invertebrate sequence entries, part 449. 1496. gbinv45.seq - Invertebrate sequence entries, part 45. 1497. gbinv450.seq - Invertebrate sequence entries, part 450. 1498. gbinv451.seq - Invertebrate sequence entries, part 451. 1499. gbinv452.seq - Invertebrate sequence entries, part 452. 1500. gbinv453.seq - Invertebrate sequence entries, part 453. 1501. gbinv454.seq - Invertebrate sequence entries, part 454. 1502. gbinv455.seq - Invertebrate sequence entries, part 455. 1503. gbinv456.seq - Invertebrate sequence entries, part 456. 1504. gbinv457.seq - Invertebrate sequence entries, part 457. 1505. gbinv458.seq - Invertebrate sequence entries, part 458. 1506. gbinv459.seq - Invertebrate sequence entries, part 459. 1507. gbinv46.seq - Invertebrate sequence entries, part 46. 1508. gbinv460.seq - Invertebrate sequence entries, part 460. 1509. gbinv461.seq - Invertebrate sequence entries, part 461. 1510. gbinv462.seq - Invertebrate sequence entries, part 462. 1511. gbinv463.seq - Invertebrate sequence entries, part 463. 1512. gbinv464.seq - Invertebrate sequence entries, part 464. 1513. gbinv465.seq - Invertebrate sequence entries, part 465. 1514. gbinv466.seq - Invertebrate sequence entries, part 466. 1515. gbinv467.seq - Invertebrate sequence entries, part 467. 1516. gbinv468.seq - Invertebrate sequence entries, part 468. 1517. gbinv469.seq - Invertebrate sequence entries, part 469. 1518. gbinv47.seq - Invertebrate sequence entries, part 47. 1519. gbinv470.seq - Invertebrate sequence entries, part 470. 1520. gbinv471.seq - Invertebrate sequence entries, part 471. 1521. gbinv472.seq - Invertebrate sequence entries, part 472. 1522. gbinv473.seq - Invertebrate sequence entries, part 473. 1523. gbinv474.seq - Invertebrate sequence entries, part 474. 1524. gbinv475.seq - Invertebrate sequence entries, part 475. 1525. gbinv476.seq - Invertebrate sequence entries, part 476. 1526. gbinv477.seq - Invertebrate sequence entries, part 477. 1527. gbinv478.seq - Invertebrate sequence entries, part 478. 1528. gbinv479.seq - Invertebrate sequence entries, part 479. 1529. gbinv48.seq - Invertebrate sequence entries, part 48. 1530. gbinv480.seq - Invertebrate sequence entries, part 480. 1531. gbinv481.seq - Invertebrate sequence entries, part 481. 1532. gbinv482.seq - Invertebrate sequence entries, part 482. 1533. gbinv483.seq - Invertebrate sequence entries, part 483. 1534. gbinv484.seq - Invertebrate sequence entries, part 484. 1535. gbinv485.seq - Invertebrate sequence entries, part 485. 1536. gbinv486.seq - Invertebrate sequence entries, part 486. 1537. gbinv487.seq - Invertebrate sequence entries, part 487. 1538. gbinv488.seq - Invertebrate sequence entries, part 488. 1539. gbinv489.seq - Invertebrate sequence entries, part 489. 1540. gbinv49.seq - Invertebrate sequence entries, part 49. 1541. gbinv490.seq - Invertebrate sequence entries, part 490. 1542. gbinv491.seq - Invertebrate sequence entries, part 491. 1543. gbinv492.seq - Invertebrate sequence entries, part 492. 1544. gbinv493.seq - Invertebrate sequence entries, part 493. 1545. gbinv494.seq - Invertebrate sequence entries, part 494. 1546. gbinv495.seq - Invertebrate sequence entries, part 495. 1547. gbinv496.seq - Invertebrate sequence entries, part 496. 1548. gbinv497.seq - Invertebrate sequence entries, part 497. 1549. gbinv498.seq - Invertebrate sequence entries, part 498. 1550. gbinv499.seq - Invertebrate sequence entries, part 499. 1551. gbinv5.seq - Invertebrate sequence entries, part 5. 1552. gbinv50.seq - Invertebrate sequence entries, part 50. 1553. gbinv500.seq - Invertebrate sequence entries, part 500. 1554. gbinv501.seq - Invertebrate sequence entries, part 501. 1555. gbinv502.seq - Invertebrate sequence entries, part 502. 1556. gbinv503.seq - Invertebrate sequence entries, part 503. 1557. gbinv504.seq - Invertebrate sequence entries, part 504. 1558. gbinv505.seq - Invertebrate sequence entries, part 505. 1559. gbinv506.seq - Invertebrate sequence entries, part 506. 1560. gbinv507.seq - Invertebrate sequence entries, part 507. 1561. gbinv508.seq - Invertebrate sequence entries, part 508. 1562. gbinv509.seq - Invertebrate sequence entries, part 509. 1563. gbinv51.seq - Invertebrate sequence entries, part 51. 1564. gbinv510.seq - Invertebrate sequence entries, part 510. 1565. gbinv511.seq - Invertebrate sequence entries, part 511. 1566. gbinv512.seq - Invertebrate sequence entries, part 512. 1567. gbinv513.seq - Invertebrate sequence entries, part 513. 1568. gbinv514.seq - Invertebrate sequence entries, part 514. 1569. gbinv515.seq - Invertebrate sequence entries, part 515. 1570. gbinv516.seq - Invertebrate sequence entries, part 516. 1571. gbinv517.seq - Invertebrate sequence entries, part 517. 1572. gbinv518.seq - Invertebrate sequence entries, part 518. 1573. gbinv519.seq - Invertebrate sequence entries, part 519. 1574. gbinv52.seq - Invertebrate sequence entries, part 52. 1575. gbinv520.seq - Invertebrate sequence entries, part 520. 1576. gbinv521.seq - Invertebrate sequence entries, part 521. 1577. gbinv522.seq - Invertebrate sequence entries, part 522. 1578. gbinv523.seq - Invertebrate sequence entries, part 523. 1579. gbinv524.seq - Invertebrate sequence entries, part 524. 1580. gbinv525.seq - Invertebrate sequence entries, part 525. 1581. gbinv526.seq - Invertebrate sequence entries, part 526. 1582. gbinv527.seq - Invertebrate sequence entries, part 527. 1583. gbinv528.seq - Invertebrate sequence entries, part 528. 1584. gbinv529.seq - Invertebrate sequence entries, part 529. 1585. gbinv53.seq - Invertebrate sequence entries, part 53. 1586. gbinv530.seq - Invertebrate sequence entries, part 530. 1587. gbinv531.seq - Invertebrate sequence entries, part 531. 1588. gbinv532.seq - Invertebrate sequence entries, part 532. 1589. gbinv533.seq - Invertebrate sequence entries, part 533. 1590. gbinv534.seq - Invertebrate sequence entries, part 534. 1591. gbinv535.seq - Invertebrate sequence entries, part 535. 1592. gbinv536.seq - Invertebrate sequence entries, part 536. 1593. gbinv537.seq - Invertebrate sequence entries, part 537. 1594. gbinv538.seq - Invertebrate sequence entries, part 538. 1595. gbinv539.seq - Invertebrate sequence entries, part 539. 1596. gbinv54.seq - Invertebrate sequence entries, part 54. 1597. gbinv540.seq - Invertebrate sequence entries, part 540. 1598. gbinv541.seq - Invertebrate sequence entries, part 541. 1599. gbinv542.seq - Invertebrate sequence entries, part 542. 1600. gbinv543.seq - Invertebrate sequence entries, part 543. 1601. gbinv544.seq - Invertebrate sequence entries, part 544. 1602. gbinv545.seq - Invertebrate sequence entries, part 545. 1603. gbinv546.seq - Invertebrate sequence entries, part 546. 1604. gbinv547.seq - Invertebrate sequence entries, part 547. 1605. gbinv548.seq - Invertebrate sequence entries, part 548. 1606. gbinv549.seq - Invertebrate sequence entries, part 549. 1607. gbinv55.seq - Invertebrate sequence entries, part 55. 1608. gbinv550.seq - Invertebrate sequence entries, part 550. 1609. gbinv551.seq - Invertebrate sequence entries, part 551. 1610. gbinv552.seq - Invertebrate sequence entries, part 552. 1611. gbinv553.seq - Invertebrate sequence entries, part 553. 1612. gbinv554.seq - Invertebrate sequence entries, part 554. 1613. gbinv555.seq - Invertebrate sequence entries, part 555. 1614. gbinv556.seq - Invertebrate sequence entries, part 556. 1615. gbinv557.seq - Invertebrate sequence entries, part 557. 1616. gbinv558.seq - Invertebrate sequence entries, part 558. 1617. gbinv559.seq - Invertebrate sequence entries, part 559. 1618. gbinv56.seq - Invertebrate sequence entries, part 56. 1619. gbinv560.seq - Invertebrate sequence entries, part 560. 1620. gbinv561.seq - Invertebrate sequence entries, part 561. 1621. gbinv562.seq - Invertebrate sequence entries, part 562. 1622. gbinv563.seq - Invertebrate sequence entries, part 563. 1623. gbinv564.seq - Invertebrate sequence entries, part 564. 1624. gbinv565.seq - Invertebrate sequence entries, part 565. 1625. gbinv566.seq - Invertebrate sequence entries, part 566. 1626. gbinv567.seq - Invertebrate sequence entries, part 567. 1627. gbinv568.seq - Invertebrate sequence entries, part 568. 1628. gbinv569.seq - Invertebrate sequence entries, part 569. 1629. gbinv57.seq - Invertebrate sequence entries, part 57. 1630. gbinv570.seq - Invertebrate sequence entries, part 570. 1631. gbinv571.seq - Invertebrate sequence entries, part 571. 1632. gbinv572.seq - Invertebrate sequence entries, part 572. 1633. gbinv573.seq - Invertebrate sequence entries, part 573. 1634. gbinv574.seq - Invertebrate sequence entries, part 574. 1635. gbinv575.seq - Invertebrate sequence entries, part 575. 1636. gbinv576.seq - Invertebrate sequence entries, part 576. 1637. gbinv577.seq - Invertebrate sequence entries, part 577. 1638. gbinv578.seq - Invertebrate sequence entries, part 578. 1639. gbinv579.seq - Invertebrate sequence entries, part 579. 1640. gbinv58.seq - Invertebrate sequence entries, part 58. 1641. gbinv580.seq - Invertebrate sequence entries, part 580. 1642. gbinv581.seq - Invertebrate sequence entries, part 581. 1643. gbinv582.seq - Invertebrate sequence entries, part 582. 1644. gbinv583.seq - Invertebrate sequence entries, part 583. 1645. gbinv584.seq - Invertebrate sequence entries, part 584. 1646. gbinv585.seq - Invertebrate sequence entries, part 585. 1647. gbinv586.seq - Invertebrate sequence entries, part 586. 1648. gbinv587.seq - Invertebrate sequence entries, part 587. 1649. gbinv588.seq - Invertebrate sequence entries, part 588. 1650. gbinv589.seq - Invertebrate sequence entries, part 589. 1651. gbinv59.seq - Invertebrate sequence entries, part 59. 1652. gbinv590.seq - Invertebrate sequence entries, part 590. 1653. gbinv591.seq - Invertebrate sequence entries, part 591. 1654. gbinv592.seq - Invertebrate sequence entries, part 592. 1655. gbinv593.seq - Invertebrate sequence entries, part 593. 1656. gbinv594.seq - Invertebrate sequence entries, part 594. 1657. gbinv595.seq - Invertebrate sequence entries, part 595. 1658. gbinv596.seq - Invertebrate sequence entries, part 596. 1659. gbinv597.seq - Invertebrate sequence entries, part 597. 1660. gbinv598.seq - Invertebrate sequence entries, part 598. 1661. gbinv599.seq - Invertebrate sequence entries, part 599. 1662. gbinv6.seq - Invertebrate sequence entries, part 6. 1663. gbinv60.seq - Invertebrate sequence entries, part 60. 1664. gbinv600.seq - Invertebrate sequence entries, part 600. 1665. gbinv601.seq - Invertebrate sequence entries, part 601. 1666. gbinv602.seq - Invertebrate sequence entries, part 602. 1667. gbinv603.seq - Invertebrate sequence entries, part 603. 1668. gbinv604.seq - Invertebrate sequence entries, part 604. 1669. gbinv605.seq - Invertebrate sequence entries, part 605. 1670. gbinv606.seq - Invertebrate sequence entries, part 606. 1671. gbinv607.seq - Invertebrate sequence entries, part 607. 1672. gbinv608.seq - Invertebrate sequence entries, part 608. 1673. gbinv609.seq - Invertebrate sequence entries, part 609. 1674. gbinv61.seq - Invertebrate sequence entries, part 61. 1675. gbinv610.seq - Invertebrate sequence entries, part 610. 1676. gbinv611.seq - Invertebrate sequence entries, part 611. 1677. gbinv612.seq - Invertebrate sequence entries, part 612. 1678. gbinv613.seq - Invertebrate sequence entries, part 613. 1679. gbinv614.seq - Invertebrate sequence entries, part 614. 1680. gbinv615.seq - Invertebrate sequence entries, part 615. 1681. gbinv616.seq - Invertebrate sequence entries, part 616. 1682. gbinv617.seq - Invertebrate sequence entries, part 617. 1683. gbinv618.seq - Invertebrate sequence entries, part 618. 1684. gbinv619.seq - Invertebrate sequence entries, part 619. 1685. gbinv62.seq - Invertebrate sequence entries, part 62. 1686. gbinv620.seq - Invertebrate sequence entries, part 620. 1687. gbinv621.seq - Invertebrate sequence entries, part 621. 1688. gbinv622.seq - Invertebrate sequence entries, part 622. 1689. gbinv623.seq - Invertebrate sequence entries, part 623. 1690. gbinv624.seq - Invertebrate sequence entries, part 624. 1691. gbinv625.seq - Invertebrate sequence entries, part 625. 1692. gbinv626.seq - Invertebrate sequence entries, part 626. 1693. gbinv627.seq - Invertebrate sequence entries, part 627. 1694. gbinv628.seq - Invertebrate sequence entries, part 628. 1695. gbinv629.seq - Invertebrate sequence entries, part 629. 1696. gbinv63.seq - Invertebrate sequence entries, part 63. 1697. gbinv630.seq - Invertebrate sequence entries, part 630. 1698. gbinv631.seq - Invertebrate sequence entries, part 631. 1699. gbinv632.seq - Invertebrate sequence entries, part 632. 1700. gbinv633.seq - Invertebrate sequence entries, part 633. 1701. gbinv634.seq - Invertebrate sequence entries, part 634. 1702. gbinv635.seq - Invertebrate sequence entries, part 635. 1703. gbinv636.seq - Invertebrate sequence entries, part 636. 1704. gbinv637.seq - Invertebrate sequence entries, part 637. 1705. gbinv638.seq - Invertebrate sequence entries, part 638. 1706. gbinv639.seq - Invertebrate sequence entries, part 639. 1707. gbinv64.seq - Invertebrate sequence entries, part 64. 1708. gbinv640.seq - Invertebrate sequence entries, part 640. 1709. gbinv641.seq - Invertebrate sequence entries, part 641. 1710. gbinv642.seq - Invertebrate sequence entries, part 642. 1711. gbinv643.seq - Invertebrate sequence entries, part 643. 1712. gbinv644.seq - Invertebrate sequence entries, part 644. 1713. gbinv645.seq - Invertebrate sequence entries, part 645. 1714. gbinv646.seq - Invertebrate sequence entries, part 646. 1715. gbinv647.seq - Invertebrate sequence entries, part 647. 1716. gbinv648.seq - Invertebrate sequence entries, part 648. 1717. gbinv649.seq - Invertebrate sequence entries, part 649. 1718. gbinv65.seq - Invertebrate sequence entries, part 65. 1719. gbinv650.seq - Invertebrate sequence entries, part 650. 1720. gbinv651.seq - Invertebrate sequence entries, part 651. 1721. gbinv652.seq - Invertebrate sequence entries, part 652. 1722. gbinv653.seq - Invertebrate sequence entries, part 653. 1723. gbinv654.seq - Invertebrate sequence entries, part 654. 1724. gbinv655.seq - Invertebrate sequence entries, part 655. 1725. gbinv656.seq - Invertebrate sequence entries, part 656. 1726. gbinv657.seq - Invertebrate sequence entries, part 657. 1727. gbinv658.seq - Invertebrate sequence entries, part 658. 1728. gbinv659.seq - Invertebrate sequence entries, part 659. 1729. gbinv66.seq - Invertebrate sequence entries, part 66. 1730. gbinv660.seq - Invertebrate sequence entries, part 660. 1731. gbinv661.seq - Invertebrate sequence entries, part 661. 1732. gbinv662.seq - Invertebrate sequence entries, part 662. 1733. gbinv663.seq - Invertebrate sequence entries, part 663. 1734. gbinv664.seq - Invertebrate sequence entries, part 664. 1735. gbinv665.seq - Invertebrate sequence entries, part 665. 1736. gbinv666.seq - Invertebrate sequence entries, part 666. 1737. gbinv667.seq - Invertebrate sequence entries, part 667. 1738. gbinv668.seq - Invertebrate sequence entries, part 668. 1739. gbinv669.seq - Invertebrate sequence entries, part 669. 1740. gbinv67.seq - Invertebrate sequence entries, part 67. 1741. gbinv670.seq - Invertebrate sequence entries, part 670. 1742. gbinv671.seq - Invertebrate sequence entries, part 671. 1743. gbinv672.seq - Invertebrate sequence entries, part 672. 1744. gbinv673.seq - Invertebrate sequence entries, part 673. 1745. gbinv674.seq - Invertebrate sequence entries, part 674. 1746. gbinv675.seq - Invertebrate sequence entries, part 675. 1747. gbinv676.seq - Invertebrate sequence entries, part 676. 1748. gbinv677.seq - Invertebrate sequence entries, part 677. 1749. gbinv678.seq - Invertebrate sequence entries, part 678. 1750. gbinv679.seq - Invertebrate sequence entries, part 679. 1751. gbinv68.seq - Invertebrate sequence entries, part 68. 1752. gbinv680.seq - Invertebrate sequence entries, part 680. 1753. gbinv681.seq - Invertebrate sequence entries, part 681. 1754. gbinv682.seq - Invertebrate sequence entries, part 682. 1755. gbinv683.seq - Invertebrate sequence entries, part 683. 1756. gbinv684.seq - Invertebrate sequence entries, part 684. 1757. gbinv685.seq - Invertebrate sequence entries, part 685. 1758. gbinv686.seq - Invertebrate sequence entries, part 686. 1759. gbinv687.seq - Invertebrate sequence entries, part 687. 1760. gbinv688.seq - Invertebrate sequence entries, part 688. 1761. gbinv689.seq - Invertebrate sequence entries, part 689. 1762. gbinv69.seq - Invertebrate sequence entries, part 69. 1763. gbinv690.seq - Invertebrate sequence entries, part 690. 1764. gbinv691.seq - Invertebrate sequence entries, part 691. 1765. gbinv692.seq - Invertebrate sequence entries, part 692. 1766. gbinv693.seq - Invertebrate sequence entries, part 693. 1767. gbinv694.seq - Invertebrate sequence entries, part 694. 1768. gbinv695.seq - Invertebrate sequence entries, part 695. 1769. gbinv696.seq - Invertebrate sequence entries, part 696. 1770. gbinv697.seq - Invertebrate sequence entries, part 697. 1771. gbinv698.seq - Invertebrate sequence entries, part 698. 1772. gbinv699.seq - Invertebrate sequence entries, part 699. 1773. gbinv7.seq - Invertebrate sequence entries, part 7. 1774. gbinv70.seq - Invertebrate sequence entries, part 70. 1775. gbinv700.seq - Invertebrate sequence entries, part 700. 1776. gbinv701.seq - Invertebrate sequence entries, part 701. 1777. gbinv702.seq - Invertebrate sequence entries, part 702. 1778. gbinv703.seq - Invertebrate sequence entries, part 703. 1779. gbinv704.seq - Invertebrate sequence entries, part 704. 1780. gbinv705.seq - Invertebrate sequence entries, part 705. 1781. gbinv706.seq - Invertebrate sequence entries, part 706. 1782. gbinv707.seq - Invertebrate sequence entries, part 707. 1783. gbinv708.seq - Invertebrate sequence entries, part 708. 1784. gbinv709.seq - Invertebrate sequence entries, part 709. 1785. gbinv71.seq - Invertebrate sequence entries, part 71. 1786. gbinv710.seq - Invertebrate sequence entries, part 710. 1787. gbinv711.seq - Invertebrate sequence entries, part 711. 1788. gbinv712.seq - Invertebrate sequence entries, part 712. 1789. gbinv713.seq - Invertebrate sequence entries, part 713. 1790. gbinv714.seq - Invertebrate sequence entries, part 714. 1791. gbinv715.seq - Invertebrate sequence entries, part 715. 1792. gbinv716.seq - Invertebrate sequence entries, part 716. 1793. gbinv717.seq - Invertebrate sequence entries, part 717. 1794. gbinv718.seq - Invertebrate sequence entries, part 718. 1795. gbinv719.seq - Invertebrate sequence entries, part 719. 1796. gbinv72.seq - Invertebrate sequence entries, part 72. 1797. gbinv720.seq - Invertebrate sequence entries, part 720. 1798. gbinv721.seq - Invertebrate sequence entries, part 721. 1799. gbinv722.seq - Invertebrate sequence entries, part 722. 1800. gbinv723.seq - Invertebrate sequence entries, part 723. 1801. gbinv724.seq - Invertebrate sequence entries, part 724. 1802. gbinv725.seq - Invertebrate sequence entries, part 725. 1803. gbinv726.seq - Invertebrate sequence entries, part 726. 1804. gbinv727.seq - Invertebrate sequence entries, part 727. 1805. gbinv728.seq - Invertebrate sequence entries, part 728. 1806. gbinv729.seq - Invertebrate sequence entries, part 729. 1807. gbinv73.seq - Invertebrate sequence entries, part 73. 1808. gbinv730.seq - Invertebrate sequence entries, part 730. 1809. gbinv731.seq - Invertebrate sequence entries, part 731. 1810. gbinv732.seq - Invertebrate sequence entries, part 732. 1811. gbinv733.seq - Invertebrate sequence entries, part 733. 1812. gbinv734.seq - Invertebrate sequence entries, part 734. 1813. gbinv735.seq - Invertebrate sequence entries, part 735. 1814. gbinv736.seq - Invertebrate sequence entries, part 736. 1815. gbinv737.seq - Invertebrate sequence entries, part 737. 1816. gbinv738.seq - Invertebrate sequence entries, part 738. 1817. gbinv739.seq - Invertebrate sequence entries, part 739. 1818. gbinv74.seq - Invertebrate sequence entries, part 74. 1819. gbinv740.seq - Invertebrate sequence entries, part 740. 1820. gbinv741.seq - Invertebrate sequence entries, part 741. 1821. gbinv742.seq - Invertebrate sequence entries, part 742. 1822. gbinv743.seq - Invertebrate sequence entries, part 743. 1823. gbinv744.seq - Invertebrate sequence entries, part 744. 1824. gbinv745.seq - Invertebrate sequence entries, part 745. 1825. gbinv746.seq - Invertebrate sequence entries, part 746. 1826. gbinv747.seq - Invertebrate sequence entries, part 747. 1827. gbinv748.seq - Invertebrate sequence entries, part 748. 1828. gbinv749.seq - Invertebrate sequence entries, part 749. 1829. gbinv75.seq - Invertebrate sequence entries, part 75. 1830. gbinv750.seq - Invertebrate sequence entries, part 750. 1831. gbinv751.seq - Invertebrate sequence entries, part 751. 1832. gbinv752.seq - Invertebrate sequence entries, part 752. 1833. gbinv753.seq - Invertebrate sequence entries, part 753. 1834. gbinv754.seq - Invertebrate sequence entries, part 754. 1835. gbinv755.seq - Invertebrate sequence entries, part 755. 1836. gbinv756.seq - Invertebrate sequence entries, part 756. 1837. gbinv757.seq - Invertebrate sequence entries, part 757. 1838. gbinv758.seq - Invertebrate sequence entries, part 758. 1839. gbinv759.seq - Invertebrate sequence entries, part 759. 1840. gbinv76.seq - Invertebrate sequence entries, part 76. 1841. gbinv760.seq - Invertebrate sequence entries, part 760. 1842. gbinv761.seq - Invertebrate sequence entries, part 761. 1843. gbinv762.seq - Invertebrate sequence entries, part 762. 1844. gbinv763.seq - Invertebrate sequence entries, part 763. 1845. gbinv764.seq - Invertebrate sequence entries, part 764. 1846. gbinv765.seq - Invertebrate sequence entries, part 765. 1847. gbinv766.seq - Invertebrate sequence entries, part 766. 1848. gbinv767.seq - Invertebrate sequence entries, part 767. 1849. gbinv768.seq - Invertebrate sequence entries, part 768. 1850. gbinv769.seq - Invertebrate sequence entries, part 769. 1851. gbinv77.seq - Invertebrate sequence entries, part 77. 1852. gbinv770.seq - Invertebrate sequence entries, part 770. 1853. gbinv771.seq - Invertebrate sequence entries, part 771. 1854. gbinv772.seq - Invertebrate sequence entries, part 772. 1855. gbinv773.seq - Invertebrate sequence entries, part 773. 1856. gbinv774.seq - Invertebrate sequence entries, part 774. 1857. gbinv775.seq - Invertebrate sequence entries, part 775. 1858. gbinv776.seq - Invertebrate sequence entries, part 776. 1859. gbinv777.seq - Invertebrate sequence entries, part 777. 1860. gbinv778.seq - Invertebrate sequence entries, part 778. 1861. gbinv779.seq - Invertebrate sequence entries, part 779. 1862. gbinv78.seq - Invertebrate sequence entries, part 78. 1863. gbinv780.seq - Invertebrate sequence entries, part 780. 1864. gbinv781.seq - Invertebrate sequence entries, part 781. 1865. gbinv782.seq - Invertebrate sequence entries, part 782. 1866. gbinv783.seq - Invertebrate sequence entries, part 783. 1867. gbinv784.seq - Invertebrate sequence entries, part 784. 1868. gbinv785.seq - Invertebrate sequence entries, part 785. 1869. gbinv786.seq - Invertebrate sequence entries, part 786. 1870. gbinv787.seq - Invertebrate sequence entries, part 787. 1871. gbinv788.seq - Invertebrate sequence entries, part 788. 1872. gbinv789.seq - Invertebrate sequence entries, part 789. 1873. gbinv79.seq - Invertebrate sequence entries, part 79. 1874. gbinv790.seq - Invertebrate sequence entries, part 790. 1875. gbinv791.seq - Invertebrate sequence entries, part 791. 1876. gbinv792.seq - Invertebrate sequence entries, part 792. 1877. gbinv793.seq - Invertebrate sequence entries, part 793. 1878. gbinv794.seq - Invertebrate sequence entries, part 794. 1879. gbinv795.seq - Invertebrate sequence entries, part 795. 1880. gbinv796.seq - Invertebrate sequence entries, part 796. 1881. gbinv797.seq - Invertebrate sequence entries, part 797. 1882. gbinv798.seq - Invertebrate sequence entries, part 798. 1883. gbinv799.seq - Invertebrate sequence entries, part 799. 1884. gbinv8.seq - Invertebrate sequence entries, part 8. 1885. gbinv80.seq - Invertebrate sequence entries, part 80. 1886. gbinv800.seq - Invertebrate sequence entries, part 800. 1887. gbinv801.seq - Invertebrate sequence entries, part 801. 1888. gbinv802.seq - Invertebrate sequence entries, part 802. 1889. gbinv803.seq - Invertebrate sequence entries, part 803. 1890. gbinv804.seq - Invertebrate sequence entries, part 804. 1891. gbinv805.seq - Invertebrate sequence entries, part 805. 1892. gbinv806.seq - Invertebrate sequence entries, part 806. 1893. gbinv807.seq - Invertebrate sequence entries, part 807. 1894. gbinv808.seq - Invertebrate sequence entries, part 808. 1895. gbinv809.seq - Invertebrate sequence entries, part 809. 1896. gbinv81.seq - Invertebrate sequence entries, part 81. 1897. gbinv810.seq - Invertebrate sequence entries, part 810. 1898. gbinv811.seq - Invertebrate sequence entries, part 811. 1899. gbinv812.seq - Invertebrate sequence entries, part 812. 1900. gbinv813.seq - Invertebrate sequence entries, part 813. 1901. gbinv814.seq - Invertebrate sequence entries, part 814. 1902. gbinv815.seq - Invertebrate sequence entries, part 815. 1903. gbinv816.seq - Invertebrate sequence entries, part 816. 1904. gbinv817.seq - Invertebrate sequence entries, part 817. 1905. gbinv818.seq - Invertebrate sequence entries, part 818. 1906. gbinv819.seq - Invertebrate sequence entries, part 819. 1907. gbinv82.seq - Invertebrate sequence entries, part 82. 1908. gbinv820.seq - Invertebrate sequence entries, part 820. 1909. gbinv821.seq - Invertebrate sequence entries, part 821. 1910. gbinv822.seq - Invertebrate sequence entries, part 822. 1911. gbinv823.seq - Invertebrate sequence entries, part 823. 1912. gbinv824.seq - Invertebrate sequence entries, part 824. 1913. gbinv825.seq - Invertebrate sequence entries, part 825. 1914. gbinv826.seq - Invertebrate sequence entries, part 826. 1915. gbinv827.seq - Invertebrate sequence entries, part 827. 1916. gbinv828.seq - Invertebrate sequence entries, part 828. 1917. gbinv829.seq - Invertebrate sequence entries, part 829. 1918. gbinv83.seq - Invertebrate sequence entries, part 83. 1919. gbinv830.seq - Invertebrate sequence entries, part 830. 1920. gbinv831.seq - Invertebrate sequence entries, part 831. 1921. gbinv832.seq - Invertebrate sequence entries, part 832. 1922. gbinv833.seq - Invertebrate sequence entries, part 833. 1923. gbinv834.seq - Invertebrate sequence entries, part 834. 1924. gbinv835.seq - Invertebrate sequence entries, part 835. 1925. gbinv836.seq - Invertebrate sequence entries, part 836. 1926. gbinv837.seq - Invertebrate sequence entries, part 837. 1927. gbinv838.seq - Invertebrate sequence entries, part 838. 1928. gbinv839.seq - Invertebrate sequence entries, part 839. 1929. gbinv84.seq - Invertebrate sequence entries, part 84. 1930. gbinv840.seq - Invertebrate sequence entries, part 840. 1931. gbinv841.seq - Invertebrate sequence entries, part 841. 1932. gbinv842.seq - Invertebrate sequence entries, part 842. 1933. gbinv843.seq - Invertebrate sequence entries, part 843. 1934. gbinv844.seq - Invertebrate sequence entries, part 844. 1935. gbinv845.seq - Invertebrate sequence entries, part 845. 1936. gbinv846.seq - Invertebrate sequence entries, part 846. 1937. gbinv847.seq - Invertebrate sequence entries, part 847. 1938. gbinv848.seq - Invertebrate sequence entries, part 848. 1939. gbinv849.seq - Invertebrate sequence entries, part 849. 1940. gbinv85.seq - Invertebrate sequence entries, part 85. 1941. gbinv850.seq - Invertebrate sequence entries, part 850. 1942. gbinv851.seq - Invertebrate sequence entries, part 851. 1943. gbinv852.seq - Invertebrate sequence entries, part 852. 1944. gbinv853.seq - Invertebrate sequence entries, part 853. 1945. gbinv854.seq - Invertebrate sequence entries, part 854. 1946. gbinv855.seq - Invertebrate sequence entries, part 855. 1947. gbinv856.seq - Invertebrate sequence entries, part 856. 1948. gbinv857.seq - Invertebrate sequence entries, part 857. 1949. gbinv858.seq - Invertebrate sequence entries, part 858. 1950. gbinv859.seq - Invertebrate sequence entries, part 859. 1951. gbinv86.seq - Invertebrate sequence entries, part 86. 1952. gbinv860.seq - Invertebrate sequence entries, part 860. 1953. gbinv861.seq - Invertebrate sequence entries, part 861. 1954. gbinv862.seq - Invertebrate sequence entries, part 862. 1955. gbinv863.seq - Invertebrate sequence entries, part 863. 1956. gbinv864.seq - Invertebrate sequence entries, part 864. 1957. gbinv865.seq - Invertebrate sequence entries, part 865. 1958. gbinv866.seq - Invertebrate sequence entries, part 866. 1959. gbinv867.seq - Invertebrate sequence entries, part 867. 1960. gbinv868.seq - Invertebrate sequence entries, part 868. 1961. gbinv869.seq - Invertebrate sequence entries, part 869. 1962. gbinv87.seq - Invertebrate sequence entries, part 87. 1963. gbinv870.seq - Invertebrate sequence entries, part 870. 1964. gbinv871.seq - Invertebrate sequence entries, part 871. 1965. gbinv872.seq - Invertebrate sequence entries, part 872. 1966. gbinv873.seq - Invertebrate sequence entries, part 873. 1967. gbinv874.seq - Invertebrate sequence entries, part 874. 1968. gbinv875.seq - Invertebrate sequence entries, part 875. 1969. gbinv876.seq - Invertebrate sequence entries, part 876. 1970. gbinv877.seq - Invertebrate sequence entries, part 877. 1971. gbinv878.seq - Invertebrate sequence entries, part 878. 1972. gbinv879.seq - Invertebrate sequence entries, part 879. 1973. gbinv88.seq - Invertebrate sequence entries, part 88. 1974. gbinv880.seq - Invertebrate sequence entries, part 880. 1975. gbinv881.seq - Invertebrate sequence entries, part 881. 1976. gbinv882.seq - Invertebrate sequence entries, part 882. 1977. gbinv883.seq - Invertebrate sequence entries, part 883. 1978. gbinv884.seq - Invertebrate sequence entries, part 884. 1979. gbinv885.seq - Invertebrate sequence entries, part 885. 1980. gbinv886.seq - Invertebrate sequence entries, part 886. 1981. gbinv887.seq - Invertebrate sequence entries, part 887. 1982. gbinv888.seq - Invertebrate sequence entries, part 888. 1983. gbinv889.seq - Invertebrate sequence entries, part 889. 1984. gbinv89.seq - Invertebrate sequence entries, part 89. 1985. gbinv890.seq - Invertebrate sequence entries, part 890. 1986. gbinv891.seq - Invertebrate sequence entries, part 891. 1987. gbinv892.seq - Invertebrate sequence entries, part 892. 1988. gbinv893.seq - Invertebrate sequence entries, part 893. 1989. gbinv894.seq - Invertebrate sequence entries, part 894. 1990. gbinv895.seq - Invertebrate sequence entries, part 895. 1991. gbinv896.seq - Invertebrate sequence entries, part 896. 1992. gbinv897.seq - Invertebrate sequence entries, part 897. 1993. gbinv898.seq - Invertebrate sequence entries, part 898. 1994. gbinv899.seq - Invertebrate sequence entries, part 899. 1995. gbinv9.seq - Invertebrate sequence entries, part 9. 1996. gbinv90.seq - Invertebrate sequence entries, part 90. 1997. gbinv900.seq - Invertebrate sequence entries, part 900. 1998. gbinv901.seq - Invertebrate sequence entries, part 901. 1999. gbinv902.seq - Invertebrate sequence entries, part 902. 2000. gbinv903.seq - Invertebrate sequence entries, part 903. 2001. gbinv904.seq - Invertebrate sequence entries, part 904. 2002. gbinv905.seq - Invertebrate sequence entries, part 905. 2003. gbinv906.seq - Invertebrate sequence entries, part 906. 2004. gbinv907.seq - Invertebrate sequence entries, part 907. 2005. gbinv908.seq - Invertebrate sequence entries, part 908. 2006. gbinv909.seq - Invertebrate sequence entries, part 909. 2007. gbinv91.seq - Invertebrate sequence entries, part 91. 2008. gbinv910.seq - Invertebrate sequence entries, part 910. 2009. gbinv911.seq - Invertebrate sequence entries, part 911. 2010. gbinv912.seq - Invertebrate sequence entries, part 912. 2011. gbinv913.seq - Invertebrate sequence entries, part 913. 2012. gbinv914.seq - Invertebrate sequence entries, part 914. 2013. gbinv915.seq - Invertebrate sequence entries, part 915. 2014. gbinv916.seq - Invertebrate sequence entries, part 916. 2015. gbinv917.seq - Invertebrate sequence entries, part 917. 2016. gbinv918.seq - Invertebrate sequence entries, part 918. 2017. gbinv919.seq - Invertebrate sequence entries, part 919. 2018. gbinv92.seq - Invertebrate sequence entries, part 92. 2019. gbinv920.seq - Invertebrate sequence entries, part 920. 2020. gbinv921.seq - Invertebrate sequence entries, part 921. 2021. gbinv922.seq - Invertebrate sequence entries, part 922. 2022. gbinv923.seq - Invertebrate sequence entries, part 923. 2023. gbinv924.seq - Invertebrate sequence entries, part 924. 2024. gbinv925.seq - Invertebrate sequence entries, part 925. 2025. gbinv926.seq - Invertebrate sequence entries, part 926. 2026. gbinv927.seq - Invertebrate sequence entries, part 927. 2027. gbinv928.seq - Invertebrate sequence entries, part 928. 2028. gbinv929.seq - Invertebrate sequence entries, part 929. 2029. gbinv93.seq - Invertebrate sequence entries, part 93. 2030. gbinv930.seq - Invertebrate sequence entries, part 930. 2031. gbinv931.seq - Invertebrate sequence entries, part 931. 2032. gbinv932.seq - Invertebrate sequence entries, part 932. 2033. gbinv933.seq - Invertebrate sequence entries, part 933. 2034. gbinv934.seq - Invertebrate sequence entries, part 934. 2035. gbinv935.seq - Invertebrate sequence entries, part 935. 2036. gbinv936.seq - Invertebrate sequence entries, part 936. 2037. gbinv937.seq - Invertebrate sequence entries, part 937. 2038. gbinv938.seq - Invertebrate sequence entries, part 938. 2039. gbinv939.seq - Invertebrate sequence entries, part 939. 2040. gbinv94.seq - Invertebrate sequence entries, part 94. 2041. gbinv940.seq - Invertebrate sequence entries, part 940. 2042. gbinv941.seq - Invertebrate sequence entries, part 941. 2043. gbinv942.seq - Invertebrate sequence entries, part 942. 2044. gbinv943.seq - Invertebrate sequence entries, part 943. 2045. gbinv944.seq - Invertebrate sequence entries, part 944. 2046. gbinv945.seq - Invertebrate sequence entries, part 945. 2047. gbinv946.seq - Invertebrate sequence entries, part 946. 2048. gbinv947.seq - Invertebrate sequence entries, part 947. 2049. gbinv948.seq - Invertebrate sequence entries, part 948. 2050. gbinv949.seq - Invertebrate sequence entries, part 949. 2051. gbinv95.seq - Invertebrate sequence entries, part 95. 2052. gbinv950.seq - Invertebrate sequence entries, part 950. 2053. gbinv951.seq - Invertebrate sequence entries, part 951. 2054. gbinv952.seq - Invertebrate sequence entries, part 952. 2055. gbinv953.seq - Invertebrate sequence entries, part 953. 2056. gbinv954.seq - Invertebrate sequence entries, part 954. 2057. gbinv955.seq - Invertebrate sequence entries, part 955. 2058. gbinv956.seq - Invertebrate sequence entries, part 956. 2059. gbinv957.seq - Invertebrate sequence entries, part 957. 2060. gbinv958.seq - Invertebrate sequence entries, part 958. 2061. gbinv959.seq - Invertebrate sequence entries, part 959. 2062. gbinv96.seq - Invertebrate sequence entries, part 96. 2063. gbinv960.seq - Invertebrate sequence entries, part 960. 2064. gbinv961.seq - Invertebrate sequence entries, part 961. 2065. gbinv962.seq - Invertebrate sequence entries, part 962. 2066. gbinv963.seq - Invertebrate sequence entries, part 963. 2067. gbinv964.seq - Invertebrate sequence entries, part 964. 2068. gbinv965.seq - Invertebrate sequence entries, part 965. 2069. gbinv966.seq - Invertebrate sequence entries, part 966. 2070. gbinv967.seq - Invertebrate sequence entries, part 967. 2071. gbinv968.seq - Invertebrate sequence entries, part 968. 2072. gbinv969.seq - Invertebrate sequence entries, part 969. 2073. gbinv97.seq - Invertebrate sequence entries, part 97. 2074. gbinv970.seq - Invertebrate sequence entries, part 970. 2075. gbinv971.seq - Invertebrate sequence entries, part 971. 2076. gbinv972.seq - Invertebrate sequence entries, part 972. 2077. gbinv973.seq - Invertebrate sequence entries, part 973. 2078. gbinv974.seq - Invertebrate sequence entries, part 974. 2079. gbinv975.seq - Invertebrate sequence entries, part 975. 2080. gbinv976.seq - Invertebrate sequence entries, part 976. 2081. gbinv977.seq - Invertebrate sequence entries, part 977. 2082. gbinv978.seq - Invertebrate sequence entries, part 978. 2083. gbinv979.seq - Invertebrate sequence entries, part 979. 2084. gbinv98.seq - Invertebrate sequence entries, part 98. 2085. gbinv980.seq - Invertebrate sequence entries, part 980. 2086. gbinv981.seq - Invertebrate sequence entries, part 981. 2087. gbinv982.seq - Invertebrate sequence entries, part 982. 2088. gbinv983.seq - Invertebrate sequence entries, part 983. 2089. gbinv984.seq - Invertebrate sequence entries, part 984. 2090. gbinv985.seq - Invertebrate sequence entries, part 985. 2091. gbinv986.seq - Invertebrate sequence entries, part 986. 2092. gbinv987.seq - Invertebrate sequence entries, part 987. 2093. gbinv988.seq - Invertebrate sequence entries, part 988. 2094. gbinv989.seq - Invertebrate sequence entries, part 989. 2095. gbinv99.seq - Invertebrate sequence entries, part 99. 2096. gbinv990.seq - Invertebrate sequence entries, part 990. 2097. gbinv991.seq - Invertebrate sequence entries, part 991. 2098. gbinv992.seq - Invertebrate sequence entries, part 992. 2099. gbinv993.seq - Invertebrate sequence entries, part 993. 2100. gbinv994.seq - Invertebrate sequence entries, part 994. 2101. gbinv995.seq - Invertebrate sequence entries, part 995. 2102. gbinv996.seq - Invertebrate sequence entries, part 996. 2103. gbinv997.seq - Invertebrate sequence entries, part 997. 2104. gbinv998.seq - Invertebrate sequence entries, part 998. 2105. gbinv999.seq - Invertebrate sequence entries, part 999. 2106. gbmam1.seq - Other mammalian sequence entries, part 1. 2107. gbmam10.seq - Other mammalian sequence entries, part 10. 2108. gbmam100.seq - Other mammalian sequence entries, part 100. 2109. gbmam101.seq - Other mammalian sequence entries, part 101. 2110. gbmam102.seq - Other mammalian sequence entries, part 102. 2111. gbmam103.seq - Other mammalian sequence entries, part 103. 2112. gbmam104.seq - Other mammalian sequence entries, part 104. 2113. gbmam105.seq - Other mammalian sequence entries, part 105. 2114. gbmam106.seq - Other mammalian sequence entries, part 106. 2115. gbmam107.seq - Other mammalian sequence entries, part 107. 2116. gbmam108.seq - Other mammalian sequence entries, part 108. 2117. gbmam109.seq - Other mammalian sequence entries, part 109. 2118. gbmam11.seq - Other mammalian sequence entries, part 11. 2119. gbmam110.seq - Other mammalian sequence entries, part 110. 2120. gbmam111.seq - Other mammalian sequence entries, part 111. 2121. gbmam112.seq - Other mammalian sequence entries, part 112. 2122. gbmam113.seq - Other mammalian sequence entries, part 113. 2123. gbmam114.seq - Other mammalian sequence entries, part 114. 2124. gbmam115.seq - Other mammalian sequence entries, part 115. 2125. gbmam116.seq - Other mammalian sequence entries, part 116. 2126. gbmam117.seq - Other mammalian sequence entries, part 117. 2127. gbmam118.seq - Other mammalian sequence entries, part 118. 2128. gbmam119.seq - Other mammalian sequence entries, part 119. 2129. gbmam12.seq - Other mammalian sequence entries, part 12. 2130. gbmam120.seq - Other mammalian sequence entries, part 120. 2131. gbmam121.seq - Other mammalian sequence entries, part 121. 2132. gbmam122.seq - Other mammalian sequence entries, part 122. 2133. gbmam123.seq - Other mammalian sequence entries, part 123. 2134. gbmam124.seq - Other mammalian sequence entries, part 124. 2135. gbmam125.seq - Other mammalian sequence entries, part 125. 2136. gbmam126.seq - Other mammalian sequence entries, part 126. 2137. gbmam127.seq - Other mammalian sequence entries, part 127. 2138. gbmam128.seq - Other mammalian sequence entries, part 128. 2139. gbmam129.seq - Other mammalian sequence entries, part 129. 2140. gbmam13.seq - Other mammalian sequence entries, part 13. 2141. gbmam130.seq - Other mammalian sequence entries, part 130. 2142. gbmam131.seq - Other mammalian sequence entries, part 131. 2143. gbmam132.seq - Other mammalian sequence entries, part 132. 2144. gbmam133.seq - Other mammalian sequence entries, part 133. 2145. gbmam134.seq - Other mammalian sequence entries, part 134. 2146. gbmam135.seq - Other mammalian sequence entries, part 135. 2147. gbmam136.seq - Other mammalian sequence entries, part 136. 2148. gbmam137.seq - Other mammalian sequence entries, part 137. 2149. gbmam138.seq - Other mammalian sequence entries, part 138. 2150. gbmam139.seq - Other mammalian sequence entries, part 139. 2151. gbmam14.seq - Other mammalian sequence entries, part 14. 2152. gbmam140.seq - Other mammalian sequence entries, part 140. 2153. gbmam141.seq - Other mammalian sequence entries, part 141. 2154. gbmam142.seq - Other mammalian sequence entries, part 142. 2155. gbmam143.seq - Other mammalian sequence entries, part 143. 2156. gbmam144.seq - Other mammalian sequence entries, part 144. 2157. gbmam145.seq - Other mammalian sequence entries, part 145. 2158. gbmam146.seq - Other mammalian sequence entries, part 146. 2159. gbmam147.seq - Other mammalian sequence entries, part 147. 2160. gbmam148.seq - Other mammalian sequence entries, part 148. 2161. gbmam149.seq - Other mammalian sequence entries, part 149. 2162. gbmam15.seq - Other mammalian sequence entries, part 15. 2163. gbmam150.seq - Other mammalian sequence entries, part 150. 2164. gbmam151.seq - Other mammalian sequence entries, part 151. 2165. gbmam152.seq - Other mammalian sequence entries, part 152. 2166. gbmam153.seq - Other mammalian sequence entries, part 153. 2167. gbmam154.seq - Other mammalian sequence entries, part 154. 2168. gbmam155.seq - Other mammalian sequence entries, part 155. 2169. gbmam156.seq - Other mammalian sequence entries, part 156. 2170. gbmam157.seq - Other mammalian sequence entries, part 157. 2171. gbmam158.seq - Other mammalian sequence entries, part 158. 2172. gbmam159.seq - Other mammalian sequence entries, part 159. 2173. gbmam16.seq - Other mammalian sequence entries, part 16. 2174. gbmam160.seq - Other mammalian sequence entries, part 160. 2175. gbmam17.seq - Other mammalian sequence entries, part 17. 2176. gbmam18.seq - Other mammalian sequence entries, part 18. 2177. gbmam19.seq - Other mammalian sequence entries, part 19. 2178. gbmam2.seq - Other mammalian sequence entries, part 2. 2179. gbmam20.seq - Other mammalian sequence entries, part 20. 2180. gbmam21.seq - Other mammalian sequence entries, part 21. 2181. gbmam22.seq - Other mammalian sequence entries, part 22. 2182. gbmam23.seq - Other mammalian sequence entries, part 23. 2183. gbmam24.seq - Other mammalian sequence entries, part 24. 2184. gbmam25.seq - Other mammalian sequence entries, part 25. 2185. gbmam26.seq - Other mammalian sequence entries, part 26. 2186. gbmam27.seq - Other mammalian sequence entries, part 27. 2187. gbmam28.seq - Other mammalian sequence entries, part 28. 2188. gbmam29.seq - Other mammalian sequence entries, part 29. 2189. gbmam3.seq - Other mammalian sequence entries, part 3. 2190. gbmam30.seq - Other mammalian sequence entries, part 30. 2191. gbmam31.seq - Other mammalian sequence entries, part 31. 2192. gbmam32.seq - Other mammalian sequence entries, part 32. 2193. gbmam33.seq - Other mammalian sequence entries, part 33. 2194. gbmam34.seq - Other mammalian sequence entries, part 34. 2195. gbmam35.seq - Other mammalian sequence entries, part 35. 2196. gbmam36.seq - Other mammalian sequence entries, part 36. 2197. gbmam37.seq - Other mammalian sequence entries, part 37. 2198. gbmam38.seq - Other mammalian sequence entries, part 38. 2199. gbmam39.seq - Other mammalian sequence entries, part 39. 2200. gbmam4.seq - Other mammalian sequence entries, part 4. 2201. gbmam40.seq - Other mammalian sequence entries, part 40. 2202. gbmam41.seq - Other mammalian sequence entries, part 41. 2203. gbmam42.seq - Other mammalian sequence entries, part 42. 2204. gbmam43.seq - Other mammalian sequence entries, part 43. 2205. gbmam44.seq - Other mammalian sequence entries, part 44. 2206. gbmam45.seq - Other mammalian sequence entries, part 45. 2207. gbmam46.seq - Other mammalian sequence entries, part 46. 2208. gbmam47.seq - Other mammalian sequence entries, part 47. 2209. gbmam48.seq - Other mammalian sequence entries, part 48. 2210. gbmam49.seq - Other mammalian sequence entries, part 49. 2211. gbmam5.seq - Other mammalian sequence entries, part 5. 2212. gbmam50.seq - Other mammalian sequence entries, part 50. 2213. gbmam51.seq - Other mammalian sequence entries, part 51. 2214. gbmam52.seq - Other mammalian sequence entries, part 52. 2215. gbmam53.seq - Other mammalian sequence entries, part 53. 2216. gbmam54.seq - Other mammalian sequence entries, part 54. 2217. gbmam55.seq - Other mammalian sequence entries, part 55. 2218. gbmam56.seq - Other mammalian sequence entries, part 56. 2219. gbmam57.seq - Other mammalian sequence entries, part 57. 2220. gbmam58.seq - Other mammalian sequence entries, part 58. 2221. gbmam59.seq - Other mammalian sequence entries, part 59. 2222. gbmam6.seq - Other mammalian sequence entries, part 6. 2223. gbmam60.seq - Other mammalian sequence entries, part 60. 2224. gbmam61.seq - Other mammalian sequence entries, part 61. 2225. gbmam62.seq - Other mammalian sequence entries, part 62. 2226. gbmam63.seq - Other mammalian sequence entries, part 63. 2227. gbmam64.seq - Other mammalian sequence entries, part 64. 2228. gbmam65.seq - Other mammalian sequence entries, part 65. 2229. gbmam66.seq - Other mammalian sequence entries, part 66. 2230. gbmam67.seq - Other mammalian sequence entries, part 67. 2231. gbmam68.seq - Other mammalian sequence entries, part 68. 2232. gbmam69.seq - Other mammalian sequence entries, part 69. 2233. gbmam7.seq - Other mammalian sequence entries, part 7. 2234. gbmam70.seq - Other mammalian sequence entries, part 70. 2235. gbmam71.seq - Other mammalian sequence entries, part 71. 2236. gbmam72.seq - Other mammalian sequence entries, part 72. 2237. gbmam73.seq - Other mammalian sequence entries, part 73. 2238. gbmam74.seq - Other mammalian sequence entries, part 74. 2239. gbmam75.seq - Other mammalian sequence entries, part 75. 2240. gbmam76.seq - Other mammalian sequence entries, part 76. 2241. gbmam77.seq - Other mammalian sequence entries, part 77. 2242. gbmam78.seq - Other mammalian sequence entries, part 78. 2243. gbmam79.seq - Other mammalian sequence entries, part 79. 2244. gbmam8.seq - Other mammalian sequence entries, part 8. 2245. gbmam80.seq - Other mammalian sequence entries, part 80. 2246. gbmam81.seq - Other mammalian sequence entries, part 81. 2247. gbmam82.seq - Other mammalian sequence entries, part 82. 2248. gbmam83.seq - Other mammalian sequence entries, part 83. 2249. gbmam84.seq - Other mammalian sequence entries, part 84. 2250. gbmam85.seq - Other mammalian sequence entries, part 85. 2251. gbmam86.seq - Other mammalian sequence entries, part 86. 2252. gbmam87.seq - Other mammalian sequence entries, part 87. 2253. gbmam88.seq - Other mammalian sequence entries, part 88. 2254. gbmam89.seq - Other mammalian sequence entries, part 89. 2255. gbmam9.seq - Other mammalian sequence entries, part 9. 2256. gbmam90.seq - Other mammalian sequence entries, part 90. 2257. gbmam91.seq - Other mammalian sequence entries, part 91. 2258. gbmam92.seq - Other mammalian sequence entries, part 92. 2259. gbmam93.seq - Other mammalian sequence entries, part 93. 2260. gbmam94.seq - Other mammalian sequence entries, part 94. 2261. gbmam95.seq - Other mammalian sequence entries, part 95. 2262. gbmam96.seq - Other mammalian sequence entries, part 96. 2263. gbmam97.seq - Other mammalian sequence entries, part 97. 2264. gbmam98.seq - Other mammalian sequence entries, part 98. 2265. gbmam99.seq - Other mammalian sequence entries, part 99. 2266. gbnew.txt - Accession numbers of entries new since the previous release. 2267. gbpat1.seq - Patent sequence entries, part 1. 2268. gbpat10.seq - Patent sequence entries, part 10. 2269. gbpat100.seq - Patent sequence entries, part 100. 2270. gbpat101.seq - Patent sequence entries, part 101. 2271. gbpat102.seq - Patent sequence entries, part 102. 2272. gbpat103.seq - Patent sequence entries, part 103. 2273. gbpat104.seq - Patent sequence entries, part 104. 2274. gbpat105.seq - Patent sequence entries, part 105. 2275. gbpat106.seq - Patent sequence entries, part 106. 2276. gbpat107.seq - Patent sequence entries, part 107. 2277. gbpat108.seq - Patent sequence entries, part 108. 2278. gbpat109.seq - Patent sequence entries, part 109. 2279. gbpat11.seq - Patent sequence entries, part 11. 2280. gbpat12.seq - Patent sequence entries, part 12. 2281. gbpat13.seq - Patent sequence entries, part 13. 2282. gbpat14.seq - Patent sequence entries, part 14. 2283. gbpat15.seq - Patent sequence entries, part 15. 2284. gbpat16.seq - Patent sequence entries, part 16. 2285. gbpat17.seq - Patent sequence entries, part 17. 2286. gbpat18.seq - Patent sequence entries, part 18. 2287. gbpat19.seq - Patent sequence entries, part 19. 2288. gbpat2.seq - Patent sequence entries, part 2. 2289. gbpat20.seq - Patent sequence entries, part 20. 2290. gbpat21.seq - Patent sequence entries, part 21. 2291. gbpat22.seq - Patent sequence entries, part 22. 2292. gbpat23.seq - Patent sequence entries, part 23. 2293. gbpat24.seq - Patent sequence entries, part 24. 2294. gbpat25.seq - Patent sequence entries, part 25. 2295. gbpat26.seq - Patent sequence entries, part 26. 2296. gbpat27.seq - Patent sequence entries, part 27. 2297. gbpat28.seq - Patent sequence entries, part 28. 2298. gbpat29.seq - Patent sequence entries, part 29. 2299. gbpat3.seq - Patent sequence entries, part 3. 2300. gbpat30.seq - Patent sequence entries, part 30. 2301. gbpat31.seq - Patent sequence entries, part 31. 2302. gbpat32.seq - Patent sequence entries, part 32. 2303. gbpat33.seq - Patent sequence entries, part 33. 2304. gbpat34.seq - Patent sequence entries, part 34. 2305. gbpat35.seq - Patent sequence entries, part 35. 2306. gbpat36.seq - Patent sequence entries, part 36. 2307. gbpat37.seq - Patent sequence entries, part 37. 2308. gbpat38.seq - Patent sequence entries, part 38. 2309. gbpat39.seq - Patent sequence entries, part 39. 2310. gbpat4.seq - Patent sequence entries, part 4. 2311. gbpat40.seq - Patent sequence entries, part 40. 2312. gbpat41.seq - Patent sequence entries, part 41. 2313. gbpat42.seq - Patent sequence entries, part 42. 2314. gbpat43.seq - Patent sequence entries, part 43. 2315. gbpat44.seq - Patent sequence entries, part 44. 2316. gbpat45.seq - Patent sequence entries, part 45. 2317. gbpat46.seq - Patent sequence entries, part 46. 2318. gbpat47.seq - Patent sequence entries, part 47. 2319. gbpat48.seq - Patent sequence entries, part 48. 2320. gbpat49.seq - Patent sequence entries, part 49. 2321. gbpat5.seq - Patent sequence entries, part 5. 2322. gbpat50.seq - Patent sequence entries, part 50. 2323. gbpat51.seq - Patent sequence entries, part 51. 2324. gbpat52.seq - Patent sequence entries, part 52. 2325. gbpat53.seq - Patent sequence entries, part 53. 2326. gbpat54.seq - Patent sequence entries, part 54. 2327. gbpat55.seq - Patent sequence entries, part 55. 2328. gbpat56.seq - Patent sequence entries, part 56. 2329. gbpat57.seq - Patent sequence entries, part 57. 2330. gbpat58.seq - Patent sequence entries, part 58. 2331. gbpat59.seq - Patent sequence entries, part 59. 2332. gbpat6.seq - Patent sequence entries, part 6. 2333. gbpat60.seq - Patent sequence entries, part 60. 2334. gbpat61.seq - Patent sequence entries, part 61. 2335. gbpat62.seq - Patent sequence entries, part 62. 2336. gbpat63.seq - Patent sequence entries, part 63. 2337. gbpat64.seq - Patent sequence entries, part 64. 2338. gbpat65.seq - Patent sequence entries, part 65. 2339. gbpat66.seq - Patent sequence entries, part 66. 2340. gbpat67.seq - Patent sequence entries, part 67. 2341. gbpat68.seq - Patent sequence entries, part 68. 2342. gbpat69.seq - Patent sequence entries, part 69. 2343. gbpat7.seq - Patent sequence entries, part 7. 2344. gbpat70.seq - Patent sequence entries, part 70. 2345. gbpat71.seq - Patent sequence entries, part 71. 2346. gbpat72.seq - Patent sequence entries, part 72. 2347. gbpat73.seq - Patent sequence entries, part 73. 2348. gbpat74.seq - Patent sequence entries, part 74. 2349. gbpat75.seq - Patent sequence entries, part 75. 2350. gbpat76.seq - Patent sequence entries, part 76. 2351. gbpat77.seq - Patent sequence entries, part 77. 2352. gbpat78.seq - Patent sequence entries, part 78. 2353. gbpat79.seq - Patent sequence entries, part 79. 2354. gbpat8.seq - Patent sequence entries, part 8. 2355. gbpat80.seq - Patent sequence entries, part 80. 2356. gbpat81.seq - Patent sequence entries, part 81. 2357. gbpat82.seq - Patent sequence entries, part 82. 2358. gbpat83.seq - Patent sequence entries, part 83. 2359. gbpat84.seq - Patent sequence entries, part 84. 2360. gbpat85.seq - Patent sequence entries, part 85. 2361. gbpat86.seq - Patent sequence entries, part 86. 2362. gbpat87.seq - Patent sequence entries, part 87. 2363. gbpat88.seq - Patent sequence entries, part 88. 2364. gbpat89.seq - Patent sequence entries, part 89. 2365. gbpat9.seq - Patent sequence entries, part 9. 2366. gbpat90.seq - Patent sequence entries, part 90. 2367. gbpat91.seq - Patent sequence entries, part 91. 2368. gbpat92.seq - Patent sequence entries, part 92. 2369. gbpat93.seq - Patent sequence entries, part 93. 2370. gbpat94.seq - Patent sequence entries, part 94. 2371. gbpat95.seq - Patent sequence entries, part 95. 2372. gbpat96.seq - Patent sequence entries, part 96. 2373. gbpat97.seq - Patent sequence entries, part 97. 2374. gbpat98.seq - Patent sequence entries, part 98. 2375. gbpat99.seq - Patent sequence entries, part 99. 2376. gbphg1.seq - Phage sequence entries, part 1. 2377. gbphg2.seq - Phage sequence entries, part 2. 2378. gbphg3.seq - Phage sequence entries, part 3. 2379. gbpln1.seq - Plant sequence entries (including fungi and algae), part 1. 2380. gbpln10.seq - Plant sequence entries (including fungi and algae), part 10. 2381. gbpln100.seq - Plant sequence entries (including fungi and algae), part 100. 2382. gbpln1000.seq - Plant sequence entries (including fungi and algae), part 1000. 2383. gbpln1001.seq - Plant sequence entries (including fungi and algae), part 1001. 2384. gbpln1002.seq - Plant sequence entries (including fungi and algae), part 1002. 2385. gbpln1003.seq - Plant sequence entries (including fungi and algae), part 1003. 2386. gbpln1004.seq - Plant sequence entries (including fungi and algae), part 1004. 2387. gbpln1005.seq - Plant sequence entries (including fungi and algae), part 1005. 2388. gbpln1006.seq - Plant sequence entries (including fungi and algae), part 1006. 2389. gbpln1007.seq - Plant sequence entries (including fungi and algae), part 1007. 2390. gbpln1008.seq - Plant sequence entries (including fungi and algae), part 1008. 2391. gbpln1009.seq - Plant sequence entries (including fungi and algae), part 1009. 2392. gbpln101.seq - Plant sequence entries (including fungi and algae), part 101. 2393. gbpln1010.seq - Plant sequence entries (including fungi and algae), part 1010. 2394. gbpln1011.seq - Plant sequence entries (including fungi and algae), part 1011. 2395. gbpln1012.seq - Plant sequence entries (including fungi and algae), part 1012. 2396. gbpln1013.seq - Plant sequence entries (including fungi and algae), part 1013. 2397. gbpln1014.seq - Plant sequence entries (including fungi and algae), part 1014. 2398. gbpln1015.seq - Plant sequence entries (including fungi and algae), part 1015. 2399. gbpln1016.seq - Plant sequence entries (including fungi and algae), part 1016. 2400. gbpln1017.seq - Plant sequence entries (including fungi and algae), part 1017. 2401. gbpln1018.seq - Plant sequence entries (including fungi and algae), part 1018. 2402. gbpln1019.seq - Plant sequence entries (including fungi and algae), part 1019. 2403. gbpln102.seq - Plant sequence entries (including fungi and algae), part 102. 2404. gbpln1020.seq - Plant sequence entries (including fungi and algae), part 1020. 2405. gbpln1021.seq - Plant sequence entries (including fungi and algae), part 1021. 2406. gbpln1022.seq - Plant sequence entries (including fungi and algae), part 1022. 2407. gbpln1023.seq - Plant sequence entries (including fungi and algae), part 1023. 2408. gbpln1024.seq - Plant sequence entries (including fungi and algae), part 1024. 2409. gbpln1025.seq - Plant sequence entries (including fungi and algae), part 1025. 2410. gbpln1026.seq - Plant sequence entries (including fungi and algae), part 1026. 2411. gbpln1027.seq - Plant sequence entries (including fungi and algae), part 1027. 2412. gbpln1028.seq - Plant sequence entries (including fungi and algae), part 1028. 2413. gbpln1029.seq - Plant sequence entries (including fungi and algae), part 1029. 2414. gbpln103.seq - Plant sequence entries (including fungi and algae), part 103. 2415. gbpln1030.seq - Plant sequence entries (including fungi and algae), part 1030. 2416. gbpln1031.seq - Plant sequence entries (including fungi and algae), part 1031. 2417. gbpln1032.seq - Plant sequence entries (including fungi and algae), part 1032. 2418. gbpln1033.seq - Plant sequence entries (including fungi and algae), part 1033. 2419. gbpln1034.seq - Plant sequence entries (including fungi and algae), part 1034. 2420. gbpln1035.seq - Plant sequence entries (including fungi and algae), part 1035. 2421. gbpln1036.seq - Plant sequence entries (including fungi and algae), part 1036. 2422. gbpln1037.seq - Plant sequence entries (including fungi and algae), part 1037. 2423. gbpln1038.seq - Plant sequence entries (including fungi and algae), part 1038. 2424. gbpln1039.seq - Plant sequence entries (including fungi and algae), part 1039. 2425. gbpln104.seq - Plant sequence entries (including fungi and algae), part 104. 2426. gbpln1040.seq - Plant sequence entries (including fungi and algae), part 1040. 2427. gbpln1041.seq - Plant sequence entries (including fungi and algae), part 1041. 2428. gbpln1042.seq - Plant sequence entries (including fungi and algae), part 1042. 2429. gbpln1043.seq - Plant sequence entries (including fungi and algae), part 1043. 2430. gbpln1044.seq - Plant sequence entries (including fungi and algae), part 1044. 2431. gbpln1045.seq - Plant sequence entries (including fungi and algae), part 1045. 2432. gbpln1046.seq - Plant sequence entries (including fungi and algae), part 1046. 2433. gbpln1047.seq - Plant sequence entries (including fungi and algae), part 1047. 2434. gbpln1048.seq - Plant sequence entries (including fungi and algae), part 1048. 2435. gbpln1049.seq - Plant sequence entries (including fungi and algae), part 1049. 2436. gbpln105.seq - Plant sequence entries (including fungi and algae), part 105. 2437. gbpln1050.seq - Plant sequence entries (including fungi and algae), part 1050. 2438. gbpln1051.seq - Plant sequence entries (including fungi and algae), part 1051. 2439. gbpln1052.seq - Plant sequence entries (including fungi and algae), part 1052. 2440. gbpln1053.seq - Plant sequence entries (including fungi and algae), part 1053. 2441. gbpln1054.seq - Plant sequence entries (including fungi and algae), part 1054. 2442. gbpln1055.seq - Plant sequence entries (including fungi and algae), part 1055. 2443. gbpln1056.seq - Plant sequence entries (including fungi and algae), part 1056. 2444. gbpln1057.seq - Plant sequence entries (including fungi and algae), part 1057. 2445. gbpln1058.seq - Plant sequence entries (including fungi and algae), part 1058. 2446. gbpln1059.seq - Plant sequence entries (including fungi and algae), part 1059. 2447. gbpln106.seq - Plant sequence entries (including fungi and algae), part 106. 2448. gbpln1060.seq - Plant sequence entries (including fungi and algae), part 1060. 2449. gbpln1061.seq - Plant sequence entries (including fungi and algae), part 1061. 2450. gbpln1062.seq - Plant sequence entries (including fungi and algae), part 1062. 2451. gbpln1063.seq - Plant sequence entries (including fungi and algae), part 1063. 2452. gbpln1064.seq - Plant sequence entries (including fungi and algae), part 1064. 2453. gbpln1065.seq - Plant sequence entries (including fungi and algae), part 1065. 2454. gbpln1066.seq - Plant sequence entries (including fungi and algae), part 1066. 2455. gbpln1067.seq - Plant sequence entries (including fungi and algae), part 1067. 2456. gbpln1068.seq - Plant sequence entries (including fungi and algae), part 1068. 2457. gbpln1069.seq - Plant sequence entries (including fungi and algae), part 1069. 2458. gbpln107.seq - Plant sequence entries (including fungi and algae), part 107. 2459. gbpln1070.seq - Plant sequence entries (including fungi and algae), part 1070. 2460. gbpln1071.seq - Plant sequence entries (including fungi and algae), part 1071. 2461. gbpln1072.seq - Plant sequence entries (including fungi and algae), part 1072. 2462. gbpln1073.seq - Plant sequence entries (including fungi and algae), part 1073. 2463. gbpln1074.seq - Plant sequence entries (including fungi and algae), part 1074. 2464. gbpln1075.seq - Plant sequence entries (including fungi and algae), part 1075. 2465. gbpln1076.seq - Plant sequence entries (including fungi and algae), part 1076. 2466. gbpln1077.seq - Plant sequence entries (including fungi and algae), part 1077. 2467. gbpln1078.seq - Plant sequence entries (including fungi and algae), part 1078. 2468. gbpln1079.seq - Plant sequence entries (including fungi and algae), part 1079. 2469. gbpln108.seq - Plant sequence entries (including fungi and algae), part 108. 2470. gbpln1080.seq - Plant sequence entries (including fungi and algae), part 1080. 2471. gbpln1081.seq - Plant sequence entries (including fungi and algae), part 1081. 2472. gbpln1082.seq - Plant sequence entries (including fungi and algae), part 1082. 2473. gbpln1083.seq - Plant sequence entries (including fungi and algae), part 1083. 2474. gbpln1084.seq - Plant sequence entries (including fungi and algae), part 1084. 2475. gbpln1085.seq - Plant sequence entries (including fungi and algae), part 1085. 2476. gbpln1086.seq - Plant sequence entries (including fungi and algae), part 1086. 2477. gbpln1087.seq - Plant sequence entries (including fungi and algae), part 1087. 2478. gbpln1088.seq - Plant sequence entries (including fungi and algae), part 1088. 2479. gbpln1089.seq - Plant sequence entries (including fungi and algae), part 1089. 2480. gbpln109.seq - Plant sequence entries (including fungi and algae), part 109. 2481. gbpln1090.seq - Plant sequence entries (including fungi and algae), part 1090. 2482. gbpln1091.seq - Plant sequence entries (including fungi and algae), part 1091. 2483. gbpln1092.seq - Plant sequence entries (including fungi and algae), part 1092. 2484. gbpln1093.seq - Plant sequence entries (including fungi and algae), part 1093. 2485. gbpln1094.seq - Plant sequence entries (including fungi and algae), part 1094. 2486. gbpln1095.seq - Plant sequence entries (including fungi and algae), part 1095. 2487. gbpln1096.seq - Plant sequence entries (including fungi and algae), part 1096. 2488. gbpln1097.seq - Plant sequence entries (including fungi and algae), part 1097. 2489. gbpln1098.seq - Plant sequence entries (including fungi and algae), part 1098. 2490. gbpln1099.seq - Plant sequence entries (including fungi and algae), part 1099. 2491. gbpln11.seq - Plant sequence entries (including fungi and algae), part 11. 2492. gbpln110.seq - Plant sequence entries (including fungi and algae), part 110. 2493. gbpln1100.seq - Plant sequence entries (including fungi and algae), part 1100. 2494. gbpln1101.seq - Plant sequence entries (including fungi and algae), part 1101. 2495. gbpln1102.seq - Plant sequence entries (including fungi and algae), part 1102. 2496. gbpln1103.seq - Plant sequence entries (including fungi and algae), part 1103. 2497. gbpln1104.seq - Plant sequence entries (including fungi and algae), part 1104. 2498. gbpln1105.seq - Plant sequence entries (including fungi and algae), part 1105. 2499. gbpln1106.seq - Plant sequence entries (including fungi and algae), part 1106. 2500. gbpln1107.seq - Plant sequence entries (including fungi and algae), part 1107. 2501. gbpln1108.seq - Plant sequence entries (including fungi and algae), part 1108. 2502. gbpln1109.seq - Plant sequence entries (including fungi and algae), part 1109. 2503. gbpln111.seq - Plant sequence entries (including fungi and algae), part 111. 2504. gbpln1110.seq - Plant sequence entries (including fungi and algae), part 1110. 2505. gbpln1111.seq - Plant sequence entries (including fungi and algae), part 1111. 2506. gbpln1112.seq - Plant sequence entries (including fungi and algae), part 1112. 2507. gbpln1113.seq - Plant sequence entries (including fungi and algae), part 1113. 2508. gbpln1114.seq - Plant sequence entries (including fungi and algae), part 1114. 2509. gbpln1115.seq - Plant sequence entries (including fungi and algae), part 1115. 2510. gbpln1116.seq - Plant sequence entries (including fungi and algae), part 1116. 2511. gbpln1117.seq - Plant sequence entries (including fungi and algae), part 1117. 2512. gbpln1118.seq - Plant sequence entries (including fungi and algae), part 1118. 2513. gbpln1119.seq - Plant sequence entries (including fungi and algae), part 1119. 2514. gbpln112.seq - Plant sequence entries (including fungi and algae), part 112. 2515. gbpln1120.seq - Plant sequence entries (including fungi and algae), part 1120. 2516. gbpln1121.seq - Plant sequence entries (including fungi and algae), part 1121. 2517. gbpln1122.seq - Plant sequence entries (including fungi and algae), part 1122. 2518. gbpln1123.seq - Plant sequence entries (including fungi and algae), part 1123. 2519. gbpln1124.seq - Plant sequence entries (including fungi and algae), part 1124. 2520. gbpln1125.seq - Plant sequence entries (including fungi and algae), part 1125. 2521. gbpln1126.seq - Plant sequence entries (including fungi and algae), part 1126. 2522. gbpln1127.seq - Plant sequence entries (including fungi and algae), part 1127. 2523. gbpln1128.seq - Plant sequence entries (including fungi and algae), part 1128. 2524. gbpln1129.seq - Plant sequence entries (including fungi and algae), part 1129. 2525. gbpln113.seq - Plant sequence entries (including fungi and algae), part 113. 2526. gbpln1130.seq - Plant sequence entries (including fungi and algae), part 1130. 2527. gbpln1131.seq - Plant sequence entries (including fungi and algae), part 1131. 2528. gbpln1132.seq - Plant sequence entries (including fungi and algae), part 1132. 2529. gbpln1133.seq - Plant sequence entries (including fungi and algae), part 1133. 2530. gbpln1134.seq - Plant sequence entries (including fungi and algae), part 1134. 2531. gbpln1135.seq - Plant sequence entries (including fungi and algae), part 1135. 2532. gbpln1136.seq - Plant sequence entries (including fungi and algae), part 1136. 2533. gbpln1137.seq - Plant sequence entries (including fungi and algae), part 1137. 2534. gbpln1138.seq - Plant sequence entries (including fungi and algae), part 1138. 2535. gbpln1139.seq - Plant sequence entries (including fungi and algae), part 1139. 2536. gbpln114.seq - Plant sequence entries (including fungi and algae), part 114. 2537. gbpln1140.seq - Plant sequence entries (including fungi and algae), part 1140. 2538. gbpln1141.seq - Plant sequence entries (including fungi and algae), part 1141. 2539. gbpln1142.seq - Plant sequence entries (including fungi and algae), part 1142. 2540. gbpln1143.seq - Plant sequence entries (including fungi and algae), part 1143. 2541. gbpln1144.seq - Plant sequence entries (including fungi and algae), part 1144. 2542. gbpln1145.seq - Plant sequence entries (including fungi and algae), part 1145. 2543. gbpln1146.seq - Plant sequence entries (including fungi and algae), part 1146. 2544. gbpln1147.seq - Plant sequence entries (including fungi and algae), part 1147. 2545. gbpln1148.seq - Plant sequence entries (including fungi and algae), part 1148. 2546. gbpln1149.seq - Plant sequence entries (including fungi and algae), part 1149. 2547. gbpln115.seq - Plant sequence entries (including fungi and algae), part 115. 2548. gbpln1150.seq - Plant sequence entries (including fungi and algae), part 1150. 2549. gbpln1151.seq - Plant sequence entries (including fungi and algae), part 1151. 2550. gbpln1152.seq - Plant sequence entries (including fungi and algae), part 1152. 2551. gbpln1153.seq - Plant sequence entries (including fungi and algae), part 1153. 2552. gbpln1154.seq - Plant sequence entries (including fungi and algae), part 1154. 2553. gbpln1155.seq - Plant sequence entries (including fungi and algae), part 1155. 2554. gbpln1156.seq - Plant sequence entries (including fungi and algae), part 1156. 2555. gbpln1157.seq - Plant sequence entries (including fungi and algae), part 1157. 2556. gbpln1158.seq - Plant sequence entries (including fungi and algae), part 1158. 2557. gbpln1159.seq - Plant sequence entries (including fungi and algae), part 1159. 2558. gbpln116.seq - Plant sequence entries (including fungi and algae), part 116. 2559. gbpln1160.seq - Plant sequence entries (including fungi and algae), part 1160. 2560. gbpln1161.seq - Plant sequence entries (including fungi and algae), part 1161. 2561. gbpln1162.seq - Plant sequence entries (including fungi and algae), part 1162. 2562. gbpln1163.seq - Plant sequence entries (including fungi and algae), part 1163. 2563. gbpln1164.seq - Plant sequence entries (including fungi and algae), part 1164. 2564. gbpln1165.seq - Plant sequence entries (including fungi and algae), part 1165. 2565. gbpln1166.seq - Plant sequence entries (including fungi and algae), part 1166. 2566. gbpln1167.seq - Plant sequence entries (including fungi and algae), part 1167. 2567. gbpln1168.seq - Plant sequence entries (including fungi and algae), part 1168. 2568. gbpln1169.seq - Plant sequence entries (including fungi and algae), part 1169. 2569. gbpln117.seq - Plant sequence entries (including fungi and algae), part 117. 2570. gbpln1170.seq - Plant sequence entries (including fungi and algae), part 1170. 2571. gbpln1171.seq - Plant sequence entries (including fungi and algae), part 1171. 2572. gbpln1172.seq - Plant sequence entries (including fungi and algae), part 1172. 2573. gbpln1173.seq - Plant sequence entries (including fungi and algae), part 1173. 2574. gbpln1174.seq - Plant sequence entries (including fungi and algae), part 1174. 2575. gbpln1175.seq - Plant sequence entries (including fungi and algae), part 1175. 2576. gbpln1176.seq - Plant sequence entries (including fungi and algae), part 1176. 2577. gbpln1177.seq - Plant sequence entries (including fungi and algae), part 1177. 2578. gbpln1178.seq - Plant sequence entries (including fungi and algae), part 1178. 2579. gbpln1179.seq - Plant sequence entries (including fungi and algae), part 1179. 2580. gbpln118.seq - Plant sequence entries (including fungi and algae), part 118. 2581. gbpln1180.seq - Plant sequence entries (including fungi and algae), part 1180. 2582. gbpln1181.seq - Plant sequence entries (including fungi and algae), part 1181. 2583. gbpln1182.seq - Plant sequence entries (including fungi and algae), part 1182. 2584. gbpln1183.seq - Plant sequence entries (including fungi and algae), part 1183. 2585. gbpln1184.seq - Plant sequence entries (including fungi and algae), part 1184. 2586. gbpln1185.seq - Plant sequence entries (including fungi and algae), part 1185. 2587. gbpln1186.seq - Plant sequence entries (including fungi and algae), part 1186. 2588. gbpln1187.seq - Plant sequence entries (including fungi and algae), part 1187. 2589. gbpln1188.seq - Plant sequence entries (including fungi and algae), part 1188. 2590. gbpln1189.seq - Plant sequence entries (including fungi and algae), part 1189. 2591. gbpln119.seq - Plant sequence entries (including fungi and algae), part 119. 2592. gbpln1190.seq - Plant sequence entries (including fungi and algae), part 1190. 2593. gbpln1191.seq - Plant sequence entries (including fungi and algae), part 1191. 2594. gbpln1192.seq - Plant sequence entries (including fungi and algae), part 1192. 2595. gbpln1193.seq - Plant sequence entries (including fungi and algae), part 1193. 2596. gbpln1194.seq - Plant sequence entries (including fungi and algae), part 1194. 2597. gbpln1195.seq - Plant sequence entries (including fungi and algae), part 1195. 2598. gbpln1196.seq - Plant sequence entries (including fungi and algae), part 1196. 2599. gbpln1197.seq - Plant sequence entries (including fungi and algae), part 1197. 2600. gbpln1198.seq - Plant sequence entries (including fungi and algae), part 1198. 2601. gbpln1199.seq - Plant sequence entries (including fungi and algae), part 1199. 2602. gbpln12.seq - Plant sequence entries (including fungi and algae), part 12. 2603. gbpln120.seq - Plant sequence entries (including fungi and algae), part 120. 2604. gbpln1200.seq - Plant sequence entries (including fungi and algae), part 1200. 2605. gbpln1201.seq - Plant sequence entries (including fungi and algae), part 1201. 2606. gbpln1202.seq - Plant sequence entries (including fungi and algae), part 1202. 2607. gbpln1203.seq - Plant sequence entries (including fungi and algae), part 1203. 2608. gbpln1204.seq - Plant sequence entries (including fungi and algae), part 1204. 2609. gbpln1205.seq - Plant sequence entries (including fungi and algae), part 1205. 2610. gbpln1206.seq - Plant sequence entries (including fungi and algae), part 1206. 2611. gbpln1207.seq - Plant sequence entries (including fungi and algae), part 1207. 2612. gbpln1208.seq - Plant sequence entries (including fungi and algae), part 1208. 2613. gbpln1209.seq - Plant sequence entries (including fungi and algae), part 1209. 2614. gbpln121.seq - Plant sequence entries (including fungi and algae), part 121. 2615. gbpln1210.seq - Plant sequence entries (including fungi and algae), part 1210. 2616. gbpln1211.seq - Plant sequence entries (including fungi and algae), part 1211. 2617. gbpln1212.seq - Plant sequence entries (including fungi and algae), part 1212. 2618. gbpln1213.seq - Plant sequence entries (including fungi and algae), part 1213. 2619. gbpln1214.seq - Plant sequence entries (including fungi and algae), part 1214. 2620. gbpln1215.seq - Plant sequence entries (including fungi and algae), part 1215. 2621. gbpln1216.seq - Plant sequence entries (including fungi and algae), part 1216. 2622. gbpln1217.seq - Plant sequence entries (including fungi and algae), part 1217. 2623. gbpln1218.seq - Plant sequence entries (including fungi and algae), part 1218. 2624. gbpln1219.seq - Plant sequence entries (including fungi and algae), part 1219. 2625. gbpln122.seq - Plant sequence entries (including fungi and algae), part 122. 2626. gbpln1220.seq - Plant sequence entries (including fungi and algae), part 1220. 2627. gbpln1221.seq - Plant sequence entries (including fungi and algae), part 1221. 2628. gbpln1222.seq - Plant sequence entries (including fungi and algae), part 1222. 2629. gbpln1223.seq - Plant sequence entries (including fungi and algae), part 1223. 2630. gbpln1224.seq - Plant sequence entries (including fungi and algae), part 1224. 2631. gbpln1225.seq - Plant sequence entries (including fungi and algae), part 1225. 2632. gbpln1226.seq - Plant sequence entries (including fungi and algae), part 1226. 2633. gbpln1227.seq - Plant sequence entries (including fungi and algae), part 1227. 2634. gbpln1228.seq - Plant sequence entries (including fungi and algae), part 1228. 2635. gbpln1229.seq - Plant sequence entries (including fungi and algae), part 1229. 2636. gbpln123.seq - Plant sequence entries (including fungi and algae), part 123. 2637. gbpln1230.seq - Plant sequence entries (including fungi and algae), part 1230. 2638. gbpln1231.seq - Plant sequence entries (including fungi and algae), part 1231. 2639. gbpln1232.seq - Plant sequence entries (including fungi and algae), part 1232. 2640. gbpln1233.seq - Plant sequence entries (including fungi and algae), part 1233. 2641. gbpln1234.seq - Plant sequence entries (including fungi and algae), part 1234. 2642. gbpln1235.seq - Plant sequence entries (including fungi and algae), part 1235. 2643. gbpln1236.seq - Plant sequence entries (including fungi and algae), part 1236. 2644. gbpln1237.seq - Plant sequence entries (including fungi and algae), part 1237. 2645. gbpln1238.seq - Plant sequence entries (including fungi and algae), part 1238. 2646. gbpln1239.seq - Plant sequence entries (including fungi and algae), part 1239. 2647. gbpln124.seq - Plant sequence entries (including fungi and algae), part 124. 2648. gbpln1240.seq - Plant sequence entries (including fungi and algae), part 1240. 2649. gbpln1241.seq - Plant sequence entries (including fungi and algae), part 1241. 2650. gbpln1242.seq - Plant sequence entries (including fungi and algae), part 1242. 2651. gbpln1243.seq - Plant sequence entries (including fungi and algae), part 1243. 2652. gbpln1244.seq - Plant sequence entries (including fungi and algae), part 1244. 2653. gbpln1245.seq - Plant sequence entries (including fungi and algae), part 1245. 2654. gbpln1246.seq - Plant sequence entries (including fungi and algae), part 1246. 2655. gbpln1247.seq - Plant sequence entries (including fungi and algae), part 1247. 2656. gbpln1248.seq - Plant sequence entries (including fungi and algae), part 1248. 2657. gbpln1249.seq - Plant sequence entries (including fungi and algae), part 1249. 2658. gbpln125.seq - Plant sequence entries (including fungi and algae), part 125. 2659. gbpln1250.seq - Plant sequence entries (including fungi and algae), part 1250. 2660. gbpln1251.seq - Plant sequence entries (including fungi and algae), part 1251. 2661. gbpln1252.seq - Plant sequence entries (including fungi and algae), part 1252. 2662. gbpln1253.seq - Plant sequence entries (including fungi and algae), part 1253. 2663. gbpln1254.seq - Plant sequence entries (including fungi and algae), part 1254. 2664. gbpln1255.seq - Plant sequence entries (including fungi and algae), part 1255. 2665. gbpln1256.seq - Plant sequence entries (including fungi and algae), part 1256. 2666. gbpln1257.seq - Plant sequence entries (including fungi and algae), part 1257. 2667. gbpln1258.seq - Plant sequence entries (including fungi and algae), part 1258. 2668. gbpln1259.seq - Plant sequence entries (including fungi and algae), part 1259. 2669. gbpln126.seq - Plant sequence entries (including fungi and algae), part 126. 2670. gbpln1260.seq - Plant sequence entries (including fungi and algae), part 1260. 2671. gbpln1261.seq - Plant sequence entries (including fungi and algae), part 1261. 2672. gbpln1262.seq - Plant sequence entries (including fungi and algae), part 1262. 2673. gbpln1263.seq - Plant sequence entries (including fungi and algae), part 1263. 2674. gbpln1264.seq - Plant sequence entries (including fungi and algae), part 1264. 2675. gbpln1265.seq - Plant sequence entries (including fungi and algae), part 1265. 2676. gbpln1266.seq - Plant sequence entries (including fungi and algae), part 1266. 2677. gbpln1267.seq - Plant sequence entries (including fungi and algae), part 1267. 2678. gbpln1268.seq - Plant sequence entries (including fungi and algae), part 1268. 2679. gbpln1269.seq - Plant sequence entries (including fungi and algae), part 1269. 2680. gbpln127.seq - Plant sequence entries (including fungi and algae), part 127. 2681. gbpln1270.seq - Plant sequence entries (including fungi and algae), part 1270. 2682. gbpln1271.seq - Plant sequence entries (including fungi and algae), part 1271. 2683. gbpln1272.seq - Plant sequence entries (including fungi and algae), part 1272. 2684. gbpln1273.seq - Plant sequence entries (including fungi and algae), part 1273. 2685. gbpln1274.seq - Plant sequence entries (including fungi and algae), part 1274. 2686. gbpln1275.seq - Plant sequence entries (including fungi and algae), part 1275. 2687. gbpln1276.seq - Plant sequence entries (including fungi and algae), part 1276. 2688. gbpln1277.seq - Plant sequence entries (including fungi and algae), part 1277. 2689. gbpln1278.seq - Plant sequence entries (including fungi and algae), part 1278. 2690. gbpln1279.seq - Plant sequence entries (including fungi and algae), part 1279. 2691. gbpln128.seq - Plant sequence entries (including fungi and algae), part 128. 2692. gbpln1280.seq - Plant sequence entries (including fungi and algae), part 1280. 2693. gbpln1281.seq - Plant sequence entries (including fungi and algae), part 1281. 2694. gbpln1282.seq - Plant sequence entries (including fungi and algae), part 1282. 2695. gbpln1283.seq - Plant sequence entries (including fungi and algae), part 1283. 2696. gbpln1284.seq - Plant sequence entries (including fungi and algae), part 1284. 2697. gbpln1285.seq - Plant sequence entries (including fungi and algae), part 1285. 2698. gbpln1286.seq - Plant sequence entries (including fungi and algae), part 1286. 2699. gbpln1287.seq - Plant sequence entries (including fungi and algae), part 1287. 2700. gbpln1288.seq - Plant sequence entries (including fungi and algae), part 1288. 2701. gbpln1289.seq - Plant sequence entries (including fungi and algae), part 1289. 2702. gbpln129.seq - Plant sequence entries (including fungi and algae), part 129. 2703. gbpln1290.seq - Plant sequence entries (including fungi and algae), part 1290. 2704. gbpln1291.seq - Plant sequence entries (including fungi and algae), part 1291. 2705. gbpln1292.seq - Plant sequence entries (including fungi and algae), part 1292. 2706. gbpln1293.seq - Plant sequence entries (including fungi and algae), part 1293. 2707. gbpln1294.seq - Plant sequence entries (including fungi and algae), part 1294. 2708. gbpln1295.seq - Plant sequence entries (including fungi and algae), part 1295. 2709. gbpln1296.seq - Plant sequence entries (including fungi and algae), part 1296. 2710. gbpln1297.seq - Plant sequence entries (including fungi and algae), part 1297. 2711. gbpln1298.seq - Plant sequence entries (including fungi and algae), part 1298. 2712. gbpln1299.seq - Plant sequence entries (including fungi and algae), part 1299. 2713. gbpln13.seq - Plant sequence entries (including fungi and algae), part 13. 2714. gbpln130.seq - Plant sequence entries (including fungi and algae), part 130. 2715. gbpln1300.seq - Plant sequence entries (including fungi and algae), part 1300. 2716. gbpln1301.seq - Plant sequence entries (including fungi and algae), part 1301. 2717. gbpln1302.seq - Plant sequence entries (including fungi and algae), part 1302. 2718. gbpln1303.seq - Plant sequence entries (including fungi and algae), part 1303. 2719. gbpln1304.seq - Plant sequence entries (including fungi and algae), part 1304. 2720. gbpln1305.seq - Plant sequence entries (including fungi and algae), part 1305. 2721. gbpln1306.seq - Plant sequence entries (including fungi and algae), part 1306. 2722. gbpln1307.seq - Plant sequence entries (including fungi and algae), part 1307. 2723. gbpln1308.seq - Plant sequence entries (including fungi and algae), part 1308. 2724. gbpln1309.seq - Plant sequence entries (including fungi and algae), part 1309. 2725. gbpln131.seq - Plant sequence entries (including fungi and algae), part 131. 2726. gbpln1310.seq - Plant sequence entries (including fungi and algae), part 1310. 2727. gbpln1311.seq - Plant sequence entries (including fungi and algae), part 1311. 2728. gbpln1312.seq - Plant sequence entries (including fungi and algae), part 1312. 2729. gbpln1313.seq - Plant sequence entries (including fungi and algae), part 1313. 2730. gbpln1314.seq - Plant sequence entries (including fungi and algae), part 1314. 2731. gbpln1315.seq - Plant sequence entries (including fungi and algae), part 1315. 2732. gbpln1316.seq - Plant sequence entries (including fungi and algae), part 1316. 2733. gbpln1317.seq - Plant sequence entries (including fungi and algae), part 1317. 2734. gbpln1318.seq - Plant sequence entries (including fungi and algae), part 1318. 2735. gbpln1319.seq - Plant sequence entries (including fungi and algae), part 1319. 2736. gbpln132.seq - Plant sequence entries (including fungi and algae), part 132. 2737. gbpln1320.seq - Plant sequence entries (including fungi and algae), part 1320. 2738. gbpln1321.seq - Plant sequence entries (including fungi and algae), part 1321. 2739. gbpln1322.seq - Plant sequence entries (including fungi and algae), part 1322. 2740. gbpln1323.seq - Plant sequence entries (including fungi and algae), part 1323. 2741. gbpln1324.seq - Plant sequence entries (including fungi and algae), part 1324. 2742. gbpln1325.seq - Plant sequence entries (including fungi and algae), part 1325. 2743. gbpln1326.seq - Plant sequence entries (including fungi and algae), part 1326. 2744. gbpln1327.seq - Plant sequence entries (including fungi and algae), part 1327. 2745. gbpln1328.seq - Plant sequence entries (including fungi and algae), part 1328. 2746. gbpln1329.seq - Plant sequence entries (including fungi and algae), part 1329. 2747. gbpln133.seq - Plant sequence entries (including fungi and algae), part 133. 2748. gbpln1330.seq - Plant sequence entries (including fungi and algae), part 1330. 2749. gbpln1331.seq - Plant sequence entries (including fungi and algae), part 1331. 2750. gbpln1332.seq - Plant sequence entries (including fungi and algae), part 1332. 2751. gbpln1333.seq - Plant sequence entries (including fungi and algae), part 1333. 2752. gbpln1334.seq - Plant sequence entries (including fungi and algae), part 1334. 2753. gbpln1335.seq - Plant sequence entries (including fungi and algae), part 1335. 2754. gbpln1336.seq - Plant sequence entries (including fungi and algae), part 1336. 2755. gbpln1337.seq - Plant sequence entries (including fungi and algae), part 1337. 2756. gbpln1338.seq - Plant sequence entries (including fungi and algae), part 1338. 2757. gbpln1339.seq - Plant sequence entries (including fungi and algae), part 1339. 2758. gbpln134.seq - Plant sequence entries (including fungi and algae), part 134. 2759. gbpln1340.seq - Plant sequence entries (including fungi and algae), part 1340. 2760. gbpln1341.seq - Plant sequence entries (including fungi and algae), part 1341. 2761. gbpln1342.seq - Plant sequence entries (including fungi and algae), part 1342. 2762. gbpln1343.seq - Plant sequence entries (including fungi and algae), part 1343. 2763. gbpln1344.seq - Plant sequence entries (including fungi and algae), part 1344. 2764. gbpln1345.seq - Plant sequence entries (including fungi and algae), part 1345. 2765. gbpln1346.seq - Plant sequence entries (including fungi and algae), part 1346. 2766. gbpln1347.seq - Plant sequence entries (including fungi and algae), part 1347. 2767. gbpln1348.seq - Plant sequence entries (including fungi and algae), part 1348. 2768. gbpln1349.seq - Plant sequence entries (including fungi and algae), part 1349. 2769. gbpln135.seq - Plant sequence entries (including fungi and algae), part 135. 2770. gbpln1350.seq - Plant sequence entries (including fungi and algae), part 1350. 2771. gbpln1351.seq - Plant sequence entries (including fungi and algae), part 1351. 2772. gbpln1352.seq - Plant sequence entries (including fungi and algae), part 1352. 2773. gbpln1353.seq - Plant sequence entries (including fungi and algae), part 1353. 2774. gbpln1354.seq - Plant sequence entries (including fungi and algae), part 1354. 2775. gbpln1355.seq - Plant sequence entries (including fungi and algae), part 1355. 2776. gbpln1356.seq - Plant sequence entries (including fungi and algae), part 1356. 2777. gbpln1357.seq - Plant sequence entries (including fungi and algae), part 1357. 2778. gbpln1358.seq - Plant sequence entries (including fungi and algae), part 1358. 2779. gbpln1359.seq - Plant sequence entries (including fungi and algae), part 1359. 2780. gbpln136.seq - Plant sequence entries (including fungi and algae), part 136. 2781. gbpln1360.seq - Plant sequence entries (including fungi and algae), part 1360. 2782. gbpln1361.seq - Plant sequence entries (including fungi and algae), part 1361. 2783. gbpln1362.seq - Plant sequence entries (including fungi and algae), part 1362. 2784. gbpln1363.seq - Plant sequence entries (including fungi and algae), part 1363. 2785. gbpln1364.seq - Plant sequence entries (including fungi and algae), part 1364. 2786. gbpln1365.seq - Plant sequence entries (including fungi and algae), part 1365. 2787. gbpln1366.seq - Plant sequence entries (including fungi and algae), part 1366. 2788. gbpln1367.seq - Plant sequence entries (including fungi and algae), part 1367. 2789. gbpln1368.seq - Plant sequence entries (including fungi and algae), part 1368. 2790. gbpln1369.seq - Plant sequence entries (including fungi and algae), part 1369. 2791. gbpln137.seq - Plant sequence entries (including fungi and algae), part 137. 2792. gbpln1370.seq - Plant sequence entries (including fungi and algae), part 1370. 2793. gbpln1371.seq - Plant sequence entries (including fungi and algae), part 1371. 2794. gbpln1372.seq - Plant sequence entries (including fungi and algae), part 1372. 2795. gbpln1373.seq - Plant sequence entries (including fungi and algae), part 1373. 2796. gbpln1374.seq - Plant sequence entries (including fungi and algae), part 1374. 2797. gbpln1375.seq - Plant sequence entries (including fungi and algae), part 1375. 2798. gbpln1376.seq - Plant sequence entries (including fungi and algae), part 1376. 2799. gbpln1377.seq - Plant sequence entries (including fungi and algae), part 1377. 2800. gbpln1378.seq - Plant sequence entries (including fungi and algae), part 1378. 2801. gbpln1379.seq - Plant sequence entries (including fungi and algae), part 1379. 2802. gbpln138.seq - Plant sequence entries (including fungi and algae), part 138. 2803. gbpln1380.seq - Plant sequence entries (including fungi and algae), part 1380. 2804. gbpln1381.seq - Plant sequence entries (including fungi and algae), part 1381. 2805. gbpln1382.seq - Plant sequence entries (including fungi and algae), part 1382. 2806. gbpln1383.seq - Plant sequence entries (including fungi and algae), part 1383. 2807. gbpln1384.seq - Plant sequence entries (including fungi and algae), part 1384. 2808. gbpln1385.seq - Plant sequence entries (including fungi and algae), part 1385. 2809. gbpln1386.seq - Plant sequence entries (including fungi and algae), part 1386. 2810. gbpln1387.seq - Plant sequence entries (including fungi and algae), part 1387. 2811. gbpln1388.seq - Plant sequence entries (including fungi and algae), part 1388. 2812. gbpln1389.seq - Plant sequence entries (including fungi and algae), part 1389. 2813. gbpln139.seq - Plant sequence entries (including fungi and algae), part 139. 2814. gbpln1390.seq - Plant sequence entries (including fungi and algae), part 1390. 2815. gbpln1391.seq - Plant sequence entries (including fungi and algae), part 1391. 2816. gbpln1392.seq - Plant sequence entries (including fungi and algae), part 1392. 2817. gbpln1393.seq - Plant sequence entries (including fungi and algae), part 1393. 2818. gbpln1394.seq - Plant sequence entries (including fungi and algae), part 1394. 2819. gbpln1395.seq - Plant sequence entries (including fungi and algae), part 1395. 2820. gbpln1396.seq - Plant sequence entries (including fungi and algae), part 1396. 2821. gbpln1397.seq - Plant sequence entries (including fungi and algae), part 1397. 2822. gbpln1398.seq - Plant sequence entries (including fungi and algae), part 1398. 2823. gbpln1399.seq - Plant sequence entries (including fungi and algae), part 1399. 2824. gbpln14.seq - Plant sequence entries (including fungi and algae), part 14. 2825. gbpln140.seq - Plant sequence entries (including fungi and algae), part 140. 2826. gbpln1400.seq - Plant sequence entries (including fungi and algae), part 1400. 2827. gbpln1401.seq - Plant sequence entries (including fungi and algae), part 1401. 2828. gbpln1402.seq - Plant sequence entries (including fungi and algae), part 1402. 2829. gbpln1403.seq - Plant sequence entries (including fungi and algae), part 1403. 2830. gbpln1404.seq - Plant sequence entries (including fungi and algae), part 1404. 2831. gbpln1405.seq - Plant sequence entries (including fungi and algae), part 1405. 2832. gbpln1406.seq - Plant sequence entries (including fungi and algae), part 1406. 2833. gbpln1407.seq - Plant sequence entries (including fungi and algae), part 1407. 2834. gbpln1408.seq - Plant sequence entries (including fungi and algae), part 1408. 2835. gbpln1409.seq - Plant sequence entries (including fungi and algae), part 1409. 2836. gbpln141.seq - Plant sequence entries (including fungi and algae), part 141. 2837. gbpln1410.seq - Plant sequence entries (including fungi and algae), part 1410. 2838. gbpln1411.seq - Plant sequence entries (including fungi and algae), part 1411. 2839. gbpln1412.seq - Plant sequence entries (including fungi and algae), part 1412. 2840. gbpln1413.seq - Plant sequence entries (including fungi and algae), part 1413. 2841. gbpln1414.seq - Plant sequence entries (including fungi and algae), part 1414. 2842. gbpln1415.seq - Plant sequence entries (including fungi and algae), part 1415. 2843. gbpln1416.seq - Plant sequence entries (including fungi and algae), part 1416. 2844. gbpln1417.seq - Plant sequence entries (including fungi and algae), part 1417. 2845. gbpln1418.seq - Plant sequence entries (including fungi and algae), part 1418. 2846. gbpln1419.seq - Plant sequence entries (including fungi and algae), part 1419. 2847. gbpln142.seq - Plant sequence entries (including fungi and algae), part 142. 2848. gbpln1420.seq - Plant sequence entries (including fungi and algae), part 1420. 2849. gbpln1421.seq - Plant sequence entries (including fungi and algae), part 1421. 2850. gbpln1422.seq - Plant sequence entries (including fungi and algae), part 1422. 2851. gbpln1423.seq - Plant sequence entries (including fungi and algae), part 1423. 2852. gbpln1424.seq - Plant sequence entries (including fungi and algae), part 1424. 2853. gbpln1425.seq - Plant sequence entries (including fungi and algae), part 1425. 2854. gbpln1426.seq - Plant sequence entries (including fungi and algae), part 1426. 2855. gbpln1427.seq - Plant sequence entries (including fungi and algae), part 1427. 2856. gbpln1428.seq - Plant sequence entries (including fungi and algae), part 1428. 2857. gbpln1429.seq - Plant sequence entries (including fungi and algae), part 1429. 2858. gbpln143.seq - Plant sequence entries (including fungi and algae), part 143. 2859. gbpln1430.seq - Plant sequence entries (including fungi and algae), part 1430. 2860. gbpln1431.seq - Plant sequence entries (including fungi and algae), part 1431. 2861. gbpln1432.seq - Plant sequence entries (including fungi and algae), part 1432. 2862. gbpln1433.seq - Plant sequence entries (including fungi and algae), part 1433. 2863. gbpln1434.seq - Plant sequence entries (including fungi and algae), part 1434. 2864. gbpln1435.seq - Plant sequence entries (including fungi and algae), part 1435. 2865. gbpln1436.seq - Plant sequence entries (including fungi and algae), part 1436. 2866. gbpln1437.seq - Plant sequence entries (including fungi and algae), part 1437. 2867. gbpln1438.seq - Plant sequence entries (including fungi and algae), part 1438. 2868. gbpln1439.seq - Plant sequence entries (including fungi and algae), part 1439. 2869. gbpln144.seq - Plant sequence entries (including fungi and algae), part 144. 2870. gbpln1440.seq - Plant sequence entries (including fungi and algae), part 1440. 2871. gbpln1441.seq - Plant sequence entries (including fungi and algae), part 1441. 2872. gbpln1442.seq - Plant sequence entries (including fungi and algae), part 1442. 2873. gbpln1443.seq - Plant sequence entries (including fungi and algae), part 1443. 2874. gbpln1444.seq - Plant sequence entries (including fungi and algae), part 1444. 2875. gbpln1445.seq - Plant sequence entries (including fungi and algae), part 1445. 2876. gbpln1446.seq - Plant sequence entries (including fungi and algae), part 1446. 2877. gbpln1447.seq - Plant sequence entries (including fungi and algae), part 1447. 2878. gbpln1448.seq - Plant sequence entries (including fungi and algae), part 1448. 2879. gbpln1449.seq - Plant sequence entries (including fungi and algae), part 1449. 2880. gbpln145.seq - Plant sequence entries (including fungi and algae), part 145. 2881. gbpln1450.seq - Plant sequence entries (including fungi and algae), part 1450. 2882. gbpln1451.seq - Plant sequence entries (including fungi and algae), part 1451. 2883. gbpln1452.seq - Plant sequence entries (including fungi and algae), part 1452. 2884. gbpln1453.seq - Plant sequence entries (including fungi and algae), part 1453. 2885. gbpln1454.seq - Plant sequence entries (including fungi and algae), part 1454. 2886. gbpln1455.seq - Plant sequence entries (including fungi and algae), part 1455. 2887. gbpln1456.seq - Plant sequence entries (including fungi and algae), part 1456. 2888. gbpln1457.seq - Plant sequence entries (including fungi and algae), part 1457. 2889. gbpln1458.seq - Plant sequence entries (including fungi and algae), part 1458. 2890. gbpln1459.seq - Plant sequence entries (including fungi and algae), part 1459. 2891. gbpln146.seq - Plant sequence entries (including fungi and algae), part 146. 2892. gbpln1460.seq - Plant sequence entries (including fungi and algae), part 1460. 2893. gbpln1461.seq - Plant sequence entries (including fungi and algae), part 1461. 2894. gbpln1462.seq - Plant sequence entries (including fungi and algae), part 1462. 2895. gbpln1463.seq - Plant sequence entries (including fungi and algae), part 1463. 2896. gbpln1464.seq - Plant sequence entries (including fungi and algae), part 1464. 2897. gbpln1465.seq - Plant sequence entries (including fungi and algae), part 1465. 2898. gbpln1466.seq - Plant sequence entries (including fungi and algae), part 1466. 2899. gbpln1467.seq - Plant sequence entries (including fungi and algae), part 1467. 2900. gbpln1468.seq - Plant sequence entries (including fungi and algae), part 1468. 2901. gbpln1469.seq - Plant sequence entries (including fungi and algae), part 1469. 2902. gbpln147.seq - Plant sequence entries (including fungi and algae), part 147. 2903. gbpln1470.seq - Plant sequence entries (including fungi and algae), part 1470. 2904. gbpln1471.seq - Plant sequence entries (including fungi and algae), part 1471. 2905. gbpln1472.seq - Plant sequence entries (including fungi and algae), part 1472. 2906. gbpln1473.seq - Plant sequence entries (including fungi and algae), part 1473. 2907. gbpln1474.seq - Plant sequence entries (including fungi and algae), part 1474. 2908. gbpln1475.seq - Plant sequence entries (including fungi and algae), part 1475. 2909. gbpln1476.seq - Plant sequence entries (including fungi and algae), part 1476. 2910. gbpln1477.seq - Plant sequence entries (including fungi and algae), part 1477. 2911. gbpln1478.seq - Plant sequence entries (including fungi and algae), part 1478. 2912. gbpln1479.seq - Plant sequence entries (including fungi and algae), part 1479. 2913. gbpln148.seq - Plant sequence entries (including fungi and algae), part 148. 2914. gbpln1480.seq - Plant sequence entries (including fungi and algae), part 1480. 2915. gbpln1481.seq - Plant sequence entries (including fungi and algae), part 1481. 2916. gbpln1482.seq - Plant sequence entries (including fungi and algae), part 1482. 2917. gbpln1483.seq - Plant sequence entries (including fungi and algae), part 1483. 2918. gbpln1484.seq - Plant sequence entries (including fungi and algae), part 1484. 2919. gbpln1485.seq - Plant sequence entries (including fungi and algae), part 1485. 2920. gbpln1486.seq - Plant sequence entries (including fungi and algae), part 1486. 2921. gbpln1487.seq - Plant sequence entries (including fungi and algae), part 1487. 2922. gbpln1488.seq - Plant sequence entries (including fungi and algae), part 1488. 2923. gbpln1489.seq - Plant sequence entries (including fungi and algae), part 1489. 2924. gbpln149.seq - Plant sequence entries (including fungi and algae), part 149. 2925. gbpln1490.seq - Plant sequence entries (including fungi and algae), part 1490. 2926. gbpln1491.seq - Plant sequence entries (including fungi and algae), part 1491. 2927. gbpln1492.seq - Plant sequence entries (including fungi and algae), part 1492. 2928. gbpln1493.seq - Plant sequence entries (including fungi and algae), part 1493. 2929. gbpln1494.seq - Plant sequence entries (including fungi and algae), part 1494. 2930. gbpln1495.seq - Plant sequence entries (including fungi and algae), part 1495. 2931. gbpln1496.seq - Plant sequence entries (including fungi and algae), part 1496. 2932. gbpln1497.seq - Plant sequence entries (including fungi and algae), part 1497. 2933. gbpln1498.seq - Plant sequence entries (including fungi and algae), part 1498. 2934. gbpln1499.seq - Plant sequence entries (including fungi and algae), part 1499. 2935. gbpln15.seq - Plant sequence entries (including fungi and algae), part 15. 2936. gbpln150.seq - Plant sequence entries (including fungi and algae), part 150. 2937. gbpln1500.seq - Plant sequence entries (including fungi and algae), part 1500. 2938. gbpln1501.seq - Plant sequence entries (including fungi and algae), part 1501. 2939. gbpln1502.seq - Plant sequence entries (including fungi and algae), part 1502. 2940. gbpln1503.seq - Plant sequence entries (including fungi and algae), part 1503. 2941. gbpln1504.seq - Plant sequence entries (including fungi and algae), part 1504. 2942. gbpln1505.seq - Plant sequence entries (including fungi and algae), part 1505. 2943. gbpln1506.seq - Plant sequence entries (including fungi and algae), part 1506. 2944. gbpln1507.seq - Plant sequence entries (including fungi and algae), part 1507. 2945. gbpln1508.seq - Plant sequence entries (including fungi and algae), part 1508. 2946. gbpln1509.seq - Plant sequence entries (including fungi and algae), part 1509. 2947. gbpln151.seq - Plant sequence entries (including fungi and algae), part 151. 2948. gbpln1510.seq - Plant sequence entries (including fungi and algae), part 1510. 2949. gbpln1511.seq - Plant sequence entries (including fungi and algae), part 1511. 2950. gbpln1512.seq - Plant sequence entries (including fungi and algae), part 1512. 2951. gbpln1513.seq - Plant sequence entries (including fungi and algae), part 1513. 2952. gbpln1514.seq - Plant sequence entries (including fungi and algae), part 1514. 2953. gbpln1515.seq - Plant sequence entries (including fungi and algae), part 1515. 2954. gbpln1516.seq - Plant sequence entries (including fungi and algae), part 1516. 2955. gbpln1517.seq - Plant sequence entries (including fungi and algae), part 1517. 2956. gbpln1518.seq - Plant sequence entries (including fungi and algae), part 1518. 2957. gbpln1519.seq - Plant sequence entries (including fungi and algae), part 1519. 2958. gbpln152.seq - Plant sequence entries (including fungi and algae), part 152. 2959. gbpln1520.seq - Plant sequence entries (including fungi and algae), part 1520. 2960. gbpln1521.seq - Plant sequence entries (including fungi and algae), part 1521. 2961. gbpln1522.seq - Plant sequence entries (including fungi and algae), part 1522. 2962. gbpln1523.seq - Plant sequence entries (including fungi and algae), part 1523. 2963. gbpln1524.seq - Plant sequence entries (including fungi and algae), part 1524. 2964. gbpln1525.seq - Plant sequence entries (including fungi and algae), part 1525. 2965. gbpln1526.seq - Plant sequence entries (including fungi and algae), part 1526. 2966. gbpln1527.seq - Plant sequence entries (including fungi and algae), part 1527. 2967. gbpln1528.seq - Plant sequence entries (including fungi and algae), part 1528. 2968. gbpln1529.seq - Plant sequence entries (including fungi and algae), part 1529. 2969. gbpln153.seq - Plant sequence entries (including fungi and algae), part 153. 2970. gbpln1530.seq - Plant sequence entries (including fungi and algae), part 1530. 2971. gbpln1531.seq - Plant sequence entries (including fungi and algae), part 1531. 2972. gbpln1532.seq - Plant sequence entries (including fungi and algae), part 1532. 2973. gbpln1533.seq - Plant sequence entries (including fungi and algae), part 1533. 2974. gbpln1534.seq - Plant sequence entries (including fungi and algae), part 1534. 2975. gbpln1535.seq - Plant sequence entries (including fungi and algae), part 1535. 2976. gbpln1536.seq - Plant sequence entries (including fungi and algae), part 1536. 2977. gbpln1537.seq - Plant sequence entries (including fungi and algae), part 1537. 2978. gbpln1538.seq - Plant sequence entries (including fungi and algae), part 1538. 2979. gbpln1539.seq - Plant sequence entries (including fungi and algae), part 1539. 2980. gbpln154.seq - Plant sequence entries (including fungi and algae), part 154. 2981. gbpln1540.seq - Plant sequence entries (including fungi and algae), part 1540. 2982. gbpln1541.seq - Plant sequence entries (including fungi and algae), part 1541. 2983. gbpln1542.seq - Plant sequence entries (including fungi and algae), part 1542. 2984. gbpln1543.seq - Plant sequence entries (including fungi and algae), part 1543. 2985. gbpln1544.seq - Plant sequence entries (including fungi and algae), part 1544. 2986. gbpln1545.seq - Plant sequence entries (including fungi and algae), part 1545. 2987. gbpln1546.seq - Plant sequence entries (including fungi and algae), part 1546. 2988. gbpln1547.seq - Plant sequence entries (including fungi and algae), part 1547. 2989. gbpln1548.seq - Plant sequence entries (including fungi and algae), part 1548. 2990. gbpln1549.seq - Plant sequence entries (including fungi and algae), part 1549. 2991. gbpln155.seq - Plant sequence entries (including fungi and algae), part 155. 2992. gbpln1550.seq - Plant sequence entries (including fungi and algae), part 1550. 2993. gbpln1551.seq - Plant sequence entries (including fungi and algae), part 1551. 2994. gbpln1552.seq - Plant sequence entries (including fungi and algae), part 1552. 2995. gbpln1553.seq - Plant sequence entries (including fungi and algae), part 1553. 2996. gbpln1554.seq - Plant sequence entries (including fungi and algae), part 1554. 2997. gbpln1555.seq - Plant sequence entries (including fungi and algae), part 1555. 2998. gbpln1556.seq - Plant sequence entries (including fungi and algae), part 1556. 2999. gbpln1557.seq - Plant sequence entries (including fungi and algae), part 1557. 3000. gbpln1558.seq - Plant sequence entries (including fungi and algae), part 1558. 3001. gbpln1559.seq - Plant sequence entries (including fungi and algae), part 1559. 3002. gbpln156.seq - Plant sequence entries (including fungi and algae), part 156. 3003. gbpln1560.seq - Plant sequence entries (including fungi and algae), part 1560. 3004. gbpln1561.seq - Plant sequence entries (including fungi and algae), part 1561. 3005. gbpln1562.seq - Plant sequence entries (including fungi and algae), part 1562. 3006. gbpln1563.seq - Plant sequence entries (including fungi and algae), part 1563. 3007. gbpln1564.seq - Plant sequence entries (including fungi and algae), part 1564. 3008. gbpln1565.seq - Plant sequence entries (including fungi and algae), part 1565. 3009. gbpln1566.seq - Plant sequence entries (including fungi and algae), part 1566. 3010. gbpln1567.seq - Plant sequence entries (including fungi and algae), part 1567. 3011. gbpln1568.seq - Plant sequence entries (including fungi and algae), part 1568. 3012. gbpln1569.seq - Plant sequence entries (including fungi and algae), part 1569. 3013. gbpln157.seq - Plant sequence entries (including fungi and algae), part 157. 3014. gbpln1570.seq - Plant sequence entries (including fungi and algae), part 1570. 3015. gbpln1571.seq - Plant sequence entries (including fungi and algae), part 1571. 3016. gbpln1572.seq - Plant sequence entries (including fungi and algae), part 1572. 3017. gbpln1573.seq - Plant sequence entries (including fungi and algae), part 1573. 3018. gbpln1574.seq - Plant sequence entries (including fungi and algae), part 1574. 3019. gbpln1575.seq - Plant sequence entries (including fungi and algae), part 1575. 3020. gbpln1576.seq - Plant sequence entries (including fungi and algae), part 1576. 3021. gbpln1577.seq - Plant sequence entries (including fungi and algae), part 1577. 3022. gbpln1578.seq - Plant sequence entries (including fungi and algae), part 1578. 3023. gbpln1579.seq - Plant sequence entries (including fungi and algae), part 1579. 3024. gbpln158.seq - Plant sequence entries (including fungi and algae), part 158. 3025. gbpln1580.seq - Plant sequence entries (including fungi and algae), part 1580. 3026. gbpln1581.seq - Plant sequence entries (including fungi and algae), part 1581. 3027. gbpln1582.seq - Plant sequence entries (including fungi and algae), part 1582. 3028. gbpln1583.seq - Plant sequence entries (including fungi and algae), part 1583. 3029. gbpln1584.seq - Plant sequence entries (including fungi and algae), part 1584. 3030. gbpln1585.seq - Plant sequence entries (including fungi and algae), part 1585. 3031. gbpln1586.seq - Plant sequence entries (including fungi and algae), part 1586. 3032. gbpln1587.seq - Plant sequence entries (including fungi and algae), part 1587. 3033. gbpln1588.seq - Plant sequence entries (including fungi and algae), part 1588. 3034. gbpln1589.seq - Plant sequence entries (including fungi and algae), part 1589. 3035. gbpln159.seq - Plant sequence entries (including fungi and algae), part 159. 3036. gbpln1590.seq - Plant sequence entries (including fungi and algae), part 1590. 3037. gbpln1591.seq - Plant sequence entries (including fungi and algae), part 1591. 3038. gbpln1592.seq - Plant sequence entries (including fungi and algae), part 1592. 3039. gbpln1593.seq - Plant sequence entries (including fungi and algae), part 1593. 3040. gbpln1594.seq - Plant sequence entries (including fungi and algae), part 1594. 3041. gbpln1595.seq - Plant sequence entries (including fungi and algae), part 1595. 3042. gbpln1596.seq - Plant sequence entries (including fungi and algae), part 1596. 3043. gbpln1597.seq - Plant sequence entries (including fungi and algae), part 1597. 3044. gbpln1598.seq - Plant sequence entries (including fungi and algae), part 1598. 3045. gbpln1599.seq - Plant sequence entries (including fungi and algae), part 1599. 3046. gbpln16.seq - Plant sequence entries (including fungi and algae), part 16. 3047. gbpln160.seq - Plant sequence entries (including fungi and algae), part 160. 3048. gbpln1600.seq - Plant sequence entries (including fungi and algae), part 1600. 3049. gbpln1601.seq - Plant sequence entries (including fungi and algae), part 1601. 3050. gbpln1602.seq - Plant sequence entries (including fungi and algae), part 1602. 3051. gbpln1603.seq - Plant sequence entries (including fungi and algae), part 1603. 3052. gbpln1604.seq - Plant sequence entries (including fungi and algae), part 1604. 3053. gbpln1605.seq - Plant sequence entries (including fungi and algae), part 1605. 3054. gbpln1606.seq - Plant sequence entries (including fungi and algae), part 1606. 3055. gbpln1607.seq - Plant sequence entries (including fungi and algae), part 1607. 3056. gbpln1608.seq - Plant sequence entries (including fungi and algae), part 1608. 3057. gbpln1609.seq - Plant sequence entries (including fungi and algae), part 1609. 3058. gbpln161.seq - Plant sequence entries (including fungi and algae), part 161. 3059. gbpln1610.seq - Plant sequence entries (including fungi and algae), part 1610. 3060. gbpln1611.seq - Plant sequence entries (including fungi and algae), part 1611. 3061. gbpln1612.seq - Plant sequence entries (including fungi and algae), part 1612. 3062. gbpln1613.seq - Plant sequence entries (including fungi and algae), part 1613. 3063. gbpln1614.seq - Plant sequence entries (including fungi and algae), part 1614. 3064. gbpln1615.seq - Plant sequence entries (including fungi and algae), part 1615. 3065. gbpln1616.seq - Plant sequence entries (including fungi and algae), part 1616. 3066. gbpln1617.seq - Plant sequence entries (including fungi and algae), part 1617. 3067. gbpln1618.seq - Plant sequence entries (including fungi and algae), part 1618. 3068. gbpln1619.seq - Plant sequence entries (including fungi and algae), part 1619. 3069. gbpln162.seq - Plant sequence entries (including fungi and algae), part 162. 3070. gbpln1620.seq - Plant sequence entries (including fungi and algae), part 1620. 3071. gbpln1621.seq - Plant sequence entries (including fungi and algae), part 1621. 3072. gbpln1622.seq - Plant sequence entries (including fungi and algae), part 1622. 3073. gbpln1623.seq - Plant sequence entries (including fungi and algae), part 1623. 3074. gbpln1624.seq - Plant sequence entries (including fungi and algae), part 1624. 3075. gbpln1625.seq - Plant sequence entries (including fungi and algae), part 1625. 3076. gbpln1626.seq - Plant sequence entries (including fungi and algae), part 1626. 3077. gbpln1627.seq - Plant sequence entries (including fungi and algae), part 1627. 3078. gbpln1628.seq - Plant sequence entries (including fungi and algae), part 1628. 3079. gbpln1629.seq - Plant sequence entries (including fungi and algae), part 1629. 3080. gbpln163.seq - Plant sequence entries (including fungi and algae), part 163. 3081. gbpln1630.seq - Plant sequence entries (including fungi and algae), part 1630. 3082. gbpln1631.seq - Plant sequence entries (including fungi and algae), part 1631. 3083. gbpln1632.seq - Plant sequence entries (including fungi and algae), part 1632. 3084. gbpln1633.seq - Plant sequence entries (including fungi and algae), part 1633. 3085. gbpln1634.seq - Plant sequence entries (including fungi and algae), part 1634. 3086. gbpln1635.seq - Plant sequence entries (including fungi and algae), part 1635. 3087. gbpln1636.seq - Plant sequence entries (including fungi and algae), part 1636. 3088. gbpln1637.seq - Plant sequence entries (including fungi and algae), part 1637. 3089. gbpln1638.seq - Plant sequence entries (including fungi and algae), part 1638. 3090. gbpln1639.seq - Plant sequence entries (including fungi and algae), part 1639. 3091. gbpln164.seq - Plant sequence entries (including fungi and algae), part 164. 3092. gbpln1640.seq - Plant sequence entries (including fungi and algae), part 1640. 3093. gbpln1641.seq - Plant sequence entries (including fungi and algae), part 1641. 3094. gbpln1642.seq - Plant sequence entries (including fungi and algae), part 1642. 3095. gbpln1643.seq - Plant sequence entries (including fungi and algae), part 1643. 3096. gbpln1644.seq - Plant sequence entries (including fungi and algae), part 1644. 3097. gbpln1645.seq - Plant sequence entries (including fungi and algae), part 1645. 3098. gbpln1646.seq - Plant sequence entries (including fungi and algae), part 1646. 3099. gbpln1647.seq - Plant sequence entries (including fungi and algae), part 1647. 3100. gbpln1648.seq - Plant sequence entries (including fungi and algae), part 1648. 3101. gbpln1649.seq - Plant sequence entries (including fungi and algae), part 1649. 3102. gbpln165.seq - Plant sequence entries (including fungi and algae), part 165. 3103. gbpln1650.seq - Plant sequence entries (including fungi and algae), part 1650. 3104. gbpln1651.seq - Plant sequence entries (including fungi and algae), part 1651. 3105. gbpln1652.seq - Plant sequence entries (including fungi and algae), part 1652. 3106. gbpln1653.seq - Plant sequence entries (including fungi and algae), part 1653. 3107. gbpln1654.seq - Plant sequence entries (including fungi and algae), part 1654. 3108. gbpln1655.seq - Plant sequence entries (including fungi and algae), part 1655. 3109. gbpln1656.seq - Plant sequence entries (including fungi and algae), part 1656. 3110. gbpln1657.seq - Plant sequence entries (including fungi and algae), part 1657. 3111. gbpln1658.seq - Plant sequence entries (including fungi and algae), part 1658. 3112. gbpln1659.seq - Plant sequence entries (including fungi and algae), part 1659. 3113. gbpln166.seq - Plant sequence entries (including fungi and algae), part 166. 3114. gbpln1660.seq - Plant sequence entries (including fungi and algae), part 1660. 3115. gbpln1661.seq - Plant sequence entries (including fungi and algae), part 1661. 3116. gbpln167.seq - Plant sequence entries (including fungi and algae), part 167. 3117. gbpln168.seq - Plant sequence entries (including fungi and algae), part 168. 3118. gbpln169.seq - Plant sequence entries (including fungi and algae), part 169. 3119. gbpln17.seq - Plant sequence entries (including fungi and algae), part 17. 3120. gbpln170.seq - Plant sequence entries (including fungi and algae), part 170. 3121. gbpln171.seq - Plant sequence entries (including fungi and algae), part 171. 3122. gbpln172.seq - Plant sequence entries (including fungi and algae), part 172. 3123. gbpln173.seq - Plant sequence entries (including fungi and algae), part 173. 3124. gbpln174.seq - Plant sequence entries (including fungi and algae), part 174. 3125. gbpln175.seq - Plant sequence entries (including fungi and algae), part 175. 3126. gbpln176.seq - Plant sequence entries (including fungi and algae), part 176. 3127. gbpln177.seq - Plant sequence entries (including fungi and algae), part 177. 3128. gbpln178.seq - Plant sequence entries (including fungi and algae), part 178. 3129. gbpln179.seq - Plant sequence entries (including fungi and algae), part 179. 3130. gbpln18.seq - Plant sequence entries (including fungi and algae), part 18. 3131. gbpln180.seq - Plant sequence entries (including fungi and algae), part 180. 3132. gbpln181.seq - Plant sequence entries (including fungi and algae), part 181. 3133. gbpln182.seq - Plant sequence entries (including fungi and algae), part 182. 3134. gbpln183.seq - Plant sequence entries (including fungi and algae), part 183. 3135. gbpln184.seq - Plant sequence entries (including fungi and algae), part 184. 3136. gbpln185.seq - Plant sequence entries (including fungi and algae), part 185. 3137. gbpln186.seq - Plant sequence entries (including fungi and algae), part 186. 3138. gbpln187.seq - Plant sequence entries (including fungi and algae), part 187. 3139. gbpln188.seq - Plant sequence entries (including fungi and algae), part 188. 3140. gbpln189.seq - Plant sequence entries (including fungi and algae), part 189. 3141. gbpln19.seq - Plant sequence entries (including fungi and algae), part 19. 3142. gbpln190.seq - Plant sequence entries (including fungi and algae), part 190. 3143. gbpln191.seq - Plant sequence entries (including fungi and algae), part 191. 3144. gbpln192.seq - Plant sequence entries (including fungi and algae), part 192. 3145. gbpln193.seq - Plant sequence entries (including fungi and algae), part 193. 3146. gbpln194.seq - Plant sequence entries (including fungi and algae), part 194. 3147. gbpln195.seq - Plant sequence entries (including fungi and algae), part 195. 3148. gbpln196.seq - Plant sequence entries (including fungi and algae), part 196. 3149. gbpln197.seq - Plant sequence entries (including fungi and algae), part 197. 3150. gbpln198.seq - Plant sequence entries (including fungi and algae), part 198. 3151. gbpln199.seq - Plant sequence entries (including fungi and algae), part 199. 3152. gbpln2.seq - Plant sequence entries (including fungi and algae), part 2. 3153. gbpln20.seq - Plant sequence entries (including fungi and algae), part 20. 3154. gbpln200.seq - Plant sequence entries (including fungi and algae), part 200. 3155. gbpln201.seq - Plant sequence entries (including fungi and algae), part 201. 3156. gbpln202.seq - Plant sequence entries (including fungi and algae), part 202. 3157. gbpln203.seq - Plant sequence entries (including fungi and algae), part 203. 3158. gbpln204.seq - Plant sequence entries (including fungi and algae), part 204. 3159. gbpln205.seq - Plant sequence entries (including fungi and algae), part 205. 3160. gbpln206.seq - Plant sequence entries (including fungi and algae), part 206. 3161. gbpln207.seq - Plant sequence entries (including fungi and algae), part 207. 3162. gbpln208.seq - Plant sequence entries (including fungi and algae), part 208. 3163. gbpln209.seq - Plant sequence entries (including fungi and algae), part 209. 3164. gbpln21.seq - Plant sequence entries (including fungi and algae), part 21. 3165. gbpln210.seq - Plant sequence entries (including fungi and algae), part 210. 3166. gbpln211.seq - Plant sequence entries (including fungi and algae), part 211. 3167. gbpln212.seq - Plant sequence entries (including fungi and algae), part 212. 3168. gbpln213.seq - Plant sequence entries (including fungi and algae), part 213. 3169. gbpln214.seq - Plant sequence entries (including fungi and algae), part 214. 3170. gbpln215.seq - Plant sequence entries (including fungi and algae), part 215. 3171. gbpln216.seq - Plant sequence entries (including fungi and algae), part 216. 3172. gbpln217.seq - Plant sequence entries (including fungi and algae), part 217. 3173. gbpln218.seq - Plant sequence entries (including fungi and algae), part 218. 3174. gbpln219.seq - Plant sequence entries (including fungi and algae), part 219. 3175. gbpln22.seq - Plant sequence entries (including fungi and algae), part 22. 3176. gbpln220.seq - Plant sequence entries (including fungi and algae), part 220. 3177. gbpln221.seq - Plant sequence entries (including fungi and algae), part 221. 3178. gbpln222.seq - Plant sequence entries (including fungi and algae), part 222. 3179. gbpln223.seq - Plant sequence entries (including fungi and algae), part 223. 3180. gbpln224.seq - Plant sequence entries (including fungi and algae), part 224. 3181. gbpln225.seq - Plant sequence entries (including fungi and algae), part 225. 3182. gbpln226.seq - Plant sequence entries (including fungi and algae), part 226. 3183. gbpln227.seq - Plant sequence entries (including fungi and algae), part 227. 3184. gbpln228.seq - Plant sequence entries (including fungi and algae), part 228. 3185. gbpln229.seq - Plant sequence entries (including fungi and algae), part 229. 3186. gbpln23.seq - Plant sequence entries (including fungi and algae), part 23. 3187. gbpln230.seq - Plant sequence entries (including fungi and algae), part 230. 3188. gbpln231.seq - Plant sequence entries (including fungi and algae), part 231. 3189. gbpln232.seq - Plant sequence entries (including fungi and algae), part 232. 3190. gbpln233.seq - Plant sequence entries (including fungi and algae), part 233. 3191. gbpln234.seq - Plant sequence entries (including fungi and algae), part 234. 3192. gbpln235.seq - Plant sequence entries (including fungi and algae), part 235. 3193. gbpln236.seq - Plant sequence entries (including fungi and algae), part 236. 3194. gbpln237.seq - Plant sequence entries (including fungi and algae), part 237. 3195. gbpln238.seq - Plant sequence entries (including fungi and algae), part 238. 3196. gbpln239.seq - Plant sequence entries (including fungi and algae), part 239. 3197. gbpln24.seq - Plant sequence entries (including fungi and algae), part 24. 3198. gbpln240.seq - Plant sequence entries (including fungi and algae), part 240. 3199. gbpln241.seq - Plant sequence entries (including fungi and algae), part 241. 3200. gbpln242.seq - Plant sequence entries (including fungi and algae), part 242. 3201. gbpln243.seq - Plant sequence entries (including fungi and algae), part 243. 3202. gbpln244.seq - Plant sequence entries (including fungi and algae), part 244. 3203. gbpln245.seq - Plant sequence entries (including fungi and algae), part 245. 3204. gbpln246.seq - Plant sequence entries (including fungi and algae), part 246. 3205. gbpln247.seq - Plant sequence entries (including fungi and algae), part 247. 3206. gbpln248.seq - Plant sequence entries (including fungi and algae), part 248. 3207. gbpln249.seq - Plant sequence entries (including fungi and algae), part 249. 3208. gbpln25.seq - Plant sequence entries (including fungi and algae), part 25. 3209. gbpln250.seq - Plant sequence entries (including fungi and algae), part 250. 3210. gbpln251.seq - Plant sequence entries (including fungi and algae), part 251. 3211. gbpln252.seq - Plant sequence entries (including fungi and algae), part 252. 3212. gbpln253.seq - Plant sequence entries (including fungi and algae), part 253. 3213. gbpln254.seq - Plant sequence entries (including fungi and algae), part 254. 3214. gbpln255.seq - Plant sequence entries (including fungi and algae), part 255. 3215. gbpln256.seq - Plant sequence entries (including fungi and algae), part 256. 3216. gbpln257.seq - Plant sequence entries (including fungi and algae), part 257. 3217. gbpln258.seq - Plant sequence entries (including fungi and algae), part 258. 3218. gbpln259.seq - Plant sequence entries (including fungi and algae), part 259. 3219. gbpln26.seq - Plant sequence entries (including fungi and algae), part 26. 3220. gbpln260.seq - Plant sequence entries (including fungi and algae), part 260. 3221. gbpln261.seq - Plant sequence entries (including fungi and algae), part 261. 3222. gbpln262.seq - Plant sequence entries (including fungi and algae), part 262. 3223. gbpln263.seq - Plant sequence entries (including fungi and algae), part 263. 3224. gbpln264.seq - Plant sequence entries (including fungi and algae), part 264. 3225. gbpln265.seq - Plant sequence entries (including fungi and algae), part 265. 3226. gbpln266.seq - Plant sequence entries (including fungi and algae), part 266. 3227. gbpln267.seq - Plant sequence entries (including fungi and algae), part 267. 3228. gbpln268.seq - Plant sequence entries (including fungi and algae), part 268. 3229. gbpln269.seq - Plant sequence entries (including fungi and algae), part 269. 3230. gbpln27.seq - Plant sequence entries (including fungi and algae), part 27. 3231. gbpln270.seq - Plant sequence entries (including fungi and algae), part 270. 3232. gbpln271.seq - Plant sequence entries (including fungi and algae), part 271. 3233. gbpln272.seq - Plant sequence entries (including fungi and algae), part 272. 3234. gbpln273.seq - Plant sequence entries (including fungi and algae), part 273. 3235. gbpln274.seq - Plant sequence entries (including fungi and algae), part 274. 3236. gbpln275.seq - Plant sequence entries (including fungi and algae), part 275. 3237. gbpln276.seq - Plant sequence entries (including fungi and algae), part 276. 3238. gbpln277.seq - Plant sequence entries (including fungi and algae), part 277. 3239. gbpln278.seq - Plant sequence entries (including fungi and algae), part 278. 3240. gbpln279.seq - Plant sequence entries (including fungi and algae), part 279. 3241. gbpln28.seq - Plant sequence entries (including fungi and algae), part 28. 3242. gbpln280.seq - Plant sequence entries (including fungi and algae), part 280. 3243. gbpln281.seq - Plant sequence entries (including fungi and algae), part 281. 3244. gbpln282.seq - Plant sequence entries (including fungi and algae), part 282. 3245. gbpln283.seq - Plant sequence entries (including fungi and algae), part 283. 3246. gbpln284.seq - Plant sequence entries (including fungi and algae), part 284. 3247. gbpln285.seq - Plant sequence entries (including fungi and algae), part 285. 3248. gbpln286.seq - Plant sequence entries (including fungi and algae), part 286. 3249. gbpln287.seq - Plant sequence entries (including fungi and algae), part 287. 3250. gbpln288.seq - Plant sequence entries (including fungi and algae), part 288. 3251. gbpln289.seq - Plant sequence entries (including fungi and algae), part 289. 3252. gbpln29.seq - Plant sequence entries (including fungi and algae), part 29. 3253. gbpln290.seq - Plant sequence entries (including fungi and algae), part 290. 3254. gbpln291.seq - Plant sequence entries (including fungi and algae), part 291. 3255. gbpln292.seq - Plant sequence entries (including fungi and algae), part 292. 3256. gbpln293.seq - Plant sequence entries (including fungi and algae), part 293. 3257. gbpln294.seq - Plant sequence entries (including fungi and algae), part 294. 3258. gbpln295.seq - Plant sequence entries (including fungi and algae), part 295. 3259. gbpln296.seq - Plant sequence entries (including fungi and algae), part 296. 3260. gbpln297.seq - Plant sequence entries (including fungi and algae), part 297. 3261. gbpln298.seq - Plant sequence entries (including fungi and algae), part 298. 3262. gbpln299.seq - Plant sequence entries (including fungi and algae), part 299. 3263. gbpln3.seq - Plant sequence entries (including fungi and algae), part 3. 3264. gbpln30.seq - Plant sequence entries (including fungi and algae), part 30. 3265. gbpln300.seq - Plant sequence entries (including fungi and algae), part 300. 3266. gbpln301.seq - Plant sequence entries (including fungi and algae), part 301. 3267. gbpln302.seq - Plant sequence entries (including fungi and algae), part 302. 3268. gbpln303.seq - Plant sequence entries (including fungi and algae), part 303. 3269. gbpln304.seq - Plant sequence entries (including fungi and algae), part 304. 3270. gbpln305.seq - Plant sequence entries (including fungi and algae), part 305. 3271. gbpln306.seq - Plant sequence entries (including fungi and algae), part 306. 3272. gbpln307.seq - Plant sequence entries (including fungi and algae), part 307. 3273. gbpln308.seq - Plant sequence entries (including fungi and algae), part 308. 3274. gbpln309.seq - Plant sequence entries (including fungi and algae), part 309. 3275. gbpln31.seq - Plant sequence entries (including fungi and algae), part 31. 3276. gbpln310.seq - Plant sequence entries (including fungi and algae), part 310. 3277. gbpln311.seq - Plant sequence entries (including fungi and algae), part 311. 3278. gbpln312.seq - Plant sequence entries (including fungi and algae), part 312. 3279. gbpln313.seq - Plant sequence entries (including fungi and algae), part 313. 3280. gbpln314.seq - Plant sequence entries (including fungi and algae), part 314. 3281. gbpln315.seq - Plant sequence entries (including fungi and algae), part 315. 3282. gbpln316.seq - Plant sequence entries (including fungi and algae), part 316. 3283. gbpln317.seq - Plant sequence entries (including fungi and algae), part 317. 3284. gbpln318.seq - Plant sequence entries (including fungi and algae), part 318. 3285. gbpln319.seq - Plant sequence entries (including fungi and algae), part 319. 3286. gbpln32.seq - Plant sequence entries (including fungi and algae), part 32. 3287. gbpln320.seq - Plant sequence entries (including fungi and algae), part 320. 3288. gbpln321.seq - Plant sequence entries (including fungi and algae), part 321. 3289. gbpln322.seq - Plant sequence entries (including fungi and algae), part 322. 3290. gbpln323.seq - Plant sequence entries (including fungi and algae), part 323. 3291. gbpln324.seq - Plant sequence entries (including fungi and algae), part 324. 3292. gbpln325.seq - Plant sequence entries (including fungi and algae), part 325. 3293. gbpln326.seq - Plant sequence entries (including fungi and algae), part 326. 3294. gbpln327.seq - Plant sequence entries (including fungi and algae), part 327. 3295. gbpln328.seq - Plant sequence entries (including fungi and algae), part 328. 3296. gbpln329.seq - Plant sequence entries (including fungi and algae), part 329. 3297. gbpln33.seq - Plant sequence entries (including fungi and algae), part 33. 3298. gbpln330.seq - Plant sequence entries (including fungi and algae), part 330. 3299. gbpln331.seq - Plant sequence entries (including fungi and algae), part 331. 3300. gbpln332.seq - Plant sequence entries (including fungi and algae), part 332. 3301. gbpln333.seq - Plant sequence entries (including fungi and algae), part 333. 3302. gbpln334.seq - Plant sequence entries (including fungi and algae), part 334. 3303. gbpln335.seq - Plant sequence entries (including fungi and algae), part 335. 3304. gbpln336.seq - Plant sequence entries (including fungi and algae), part 336. 3305. gbpln337.seq - Plant sequence entries (including fungi and algae), part 337. 3306. gbpln338.seq - Plant sequence entries (including fungi and algae), part 338. 3307. gbpln339.seq - Plant sequence entries (including fungi and algae), part 339. 3308. gbpln34.seq - Plant sequence entries (including fungi and algae), part 34. 3309. gbpln340.seq - Plant sequence entries (including fungi and algae), part 340. 3310. gbpln341.seq - Plant sequence entries (including fungi and algae), part 341. 3311. gbpln342.seq - Plant sequence entries (including fungi and algae), part 342. 3312. gbpln343.seq - Plant sequence entries (including fungi and algae), part 343. 3313. gbpln344.seq - Plant sequence entries (including fungi and algae), part 344. 3314. gbpln345.seq - Plant sequence entries (including fungi and algae), part 345. 3315. gbpln346.seq - Plant sequence entries (including fungi and algae), part 346. 3316. gbpln347.seq - Plant sequence entries (including fungi and algae), part 347. 3317. gbpln348.seq - Plant sequence entries (including fungi and algae), part 348. 3318. gbpln349.seq - Plant sequence entries (including fungi and algae), part 349. 3319. gbpln35.seq - Plant sequence entries (including fungi and algae), part 35. 3320. gbpln350.seq - Plant sequence entries (including fungi and algae), part 350. 3321. gbpln351.seq - Plant sequence entries (including fungi and algae), part 351. 3322. gbpln352.seq - Plant sequence entries (including fungi and algae), part 352. 3323. gbpln353.seq - Plant sequence entries (including fungi and algae), part 353. 3324. gbpln354.seq - Plant sequence entries (including fungi and algae), part 354. 3325. gbpln355.seq - Plant sequence entries (including fungi and algae), part 355. 3326. gbpln356.seq - Plant sequence entries (including fungi and algae), part 356. 3327. gbpln357.seq - Plant sequence entries (including fungi and algae), part 357. 3328. gbpln358.seq - Plant sequence entries (including fungi and algae), part 358. 3329. gbpln359.seq - Plant sequence entries (including fungi and algae), part 359. 3330. gbpln36.seq - Plant sequence entries (including fungi and algae), part 36. 3331. gbpln360.seq - Plant sequence entries (including fungi and algae), part 360. 3332. gbpln361.seq - Plant sequence entries (including fungi and algae), part 361. 3333. gbpln362.seq - Plant sequence entries (including fungi and algae), part 362. 3334. gbpln363.seq - Plant sequence entries (including fungi and algae), part 363. 3335. gbpln364.seq - Plant sequence entries (including fungi and algae), part 364. 3336. gbpln365.seq - Plant sequence entries (including fungi and algae), part 365. 3337. gbpln366.seq - Plant sequence entries (including fungi and algae), part 366. 3338. gbpln367.seq - Plant sequence entries (including fungi and algae), part 367. 3339. gbpln368.seq - Plant sequence entries (including fungi and algae), part 368. 3340. gbpln369.seq - Plant sequence entries (including fungi and algae), part 369. 3341. gbpln37.seq - Plant sequence entries (including fungi and algae), part 37. 3342. gbpln370.seq - Plant sequence entries (including fungi and algae), part 370. 3343. gbpln371.seq - Plant sequence entries (including fungi and algae), part 371. 3344. gbpln372.seq - Plant sequence entries (including fungi and algae), part 372. 3345. gbpln373.seq - Plant sequence entries (including fungi and algae), part 373. 3346. gbpln374.seq - Plant sequence entries (including fungi and algae), part 374. 3347. gbpln375.seq - Plant sequence entries (including fungi and algae), part 375. 3348. gbpln376.seq - Plant sequence entries (including fungi and algae), part 376. 3349. gbpln377.seq - Plant sequence entries (including fungi and algae), part 377. 3350. gbpln378.seq - Plant sequence entries (including fungi and algae), part 378. 3351. gbpln379.seq - Plant sequence entries (including fungi and algae), part 379. 3352. gbpln38.seq - Plant sequence entries (including fungi and algae), part 38. 3353. gbpln380.seq - Plant sequence entries (including fungi and algae), part 380. 3354. gbpln381.seq - Plant sequence entries (including fungi and algae), part 381. 3355. gbpln382.seq - Plant sequence entries (including fungi and algae), part 382. 3356. gbpln383.seq - Plant sequence entries (including fungi and algae), part 383. 3357. gbpln384.seq - Plant sequence entries (including fungi and algae), part 384. 3358. gbpln385.seq - Plant sequence entries (including fungi and algae), part 385. 3359. gbpln386.seq - Plant sequence entries (including fungi and algae), part 386. 3360. gbpln387.seq - Plant sequence entries (including fungi and algae), part 387. 3361. gbpln388.seq - Plant sequence entries (including fungi and algae), part 388. 3362. gbpln389.seq - Plant sequence entries (including fungi and algae), part 389. 3363. gbpln39.seq - Plant sequence entries (including fungi and algae), part 39. 3364. gbpln390.seq - Plant sequence entries (including fungi and algae), part 390. 3365. gbpln391.seq - Plant sequence entries (including fungi and algae), part 391. 3366. gbpln392.seq - Plant sequence entries (including fungi and algae), part 392. 3367. gbpln393.seq - Plant sequence entries (including fungi and algae), part 393. 3368. gbpln394.seq - Plant sequence entries (including fungi and algae), part 394. 3369. gbpln395.seq - Plant sequence entries (including fungi and algae), part 395. 3370. gbpln396.seq - Plant sequence entries (including fungi and algae), part 396. 3371. gbpln397.seq - Plant sequence entries (including fungi and algae), part 397. 3372. gbpln398.seq - Plant sequence entries (including fungi and algae), part 398. 3373. gbpln399.seq - Plant sequence entries (including fungi and algae), part 399. 3374. gbpln4.seq - Plant sequence entries (including fungi and algae), part 4. 3375. gbpln40.seq - Plant sequence entries (including fungi and algae), part 40. 3376. gbpln400.seq - Plant sequence entries (including fungi and algae), part 400. 3377. gbpln401.seq - Plant sequence entries (including fungi and algae), part 401. 3378. gbpln402.seq - Plant sequence entries (including fungi and algae), part 402. 3379. gbpln403.seq - Plant sequence entries (including fungi and algae), part 403. 3380. gbpln404.seq - Plant sequence entries (including fungi and algae), part 404. 3381. gbpln405.seq - Plant sequence entries (including fungi and algae), part 405. 3382. gbpln406.seq - Plant sequence entries (including fungi and algae), part 406. 3383. gbpln407.seq - Plant sequence entries (including fungi and algae), part 407. 3384. gbpln408.seq - Plant sequence entries (including fungi and algae), part 408. 3385. gbpln409.seq - Plant sequence entries (including fungi and algae), part 409. 3386. gbpln41.seq - Plant sequence entries (including fungi and algae), part 41. 3387. gbpln410.seq - Plant sequence entries (including fungi and algae), part 410. 3388. gbpln411.seq - Plant sequence entries (including fungi and algae), part 411. 3389. gbpln412.seq - Plant sequence entries (including fungi and algae), part 412. 3390. gbpln413.seq - Plant sequence entries (including fungi and algae), part 413. 3391. gbpln414.seq - Plant sequence entries (including fungi and algae), part 414. 3392. gbpln415.seq - Plant sequence entries (including fungi and algae), part 415. 3393. gbpln416.seq - Plant sequence entries (including fungi and algae), part 416. 3394. gbpln417.seq - Plant sequence entries (including fungi and algae), part 417. 3395. gbpln418.seq - Plant sequence entries (including fungi and algae), part 418. 3396. gbpln419.seq - Plant sequence entries (including fungi and algae), part 419. 3397. gbpln42.seq - Plant sequence entries (including fungi and algae), part 42. 3398. gbpln420.seq - Plant sequence entries (including fungi and algae), part 420. 3399. gbpln421.seq - Plant sequence entries (including fungi and algae), part 421. 3400. gbpln422.seq - Plant sequence entries (including fungi and algae), part 422. 3401. gbpln423.seq - Plant sequence entries (including fungi and algae), part 423. 3402. gbpln424.seq - Plant sequence entries (including fungi and algae), part 424. 3403. gbpln425.seq - Plant sequence entries (including fungi and algae), part 425. 3404. gbpln426.seq - Plant sequence entries (including fungi and algae), part 426. 3405. gbpln427.seq - Plant sequence entries (including fungi and algae), part 427. 3406. gbpln428.seq - Plant sequence entries (including fungi and algae), part 428. 3407. gbpln429.seq - Plant sequence entries (including fungi and algae), part 429. 3408. gbpln43.seq - Plant sequence entries (including fungi and algae), part 43. 3409. gbpln430.seq - Plant sequence entries (including fungi and algae), part 430. 3410. gbpln431.seq - Plant sequence entries (including fungi and algae), part 431. 3411. gbpln432.seq - Plant sequence entries (including fungi and algae), part 432. 3412. gbpln433.seq - Plant sequence entries (including fungi and algae), part 433. 3413. gbpln434.seq - Plant sequence entries (including fungi and algae), part 434. 3414. gbpln435.seq - Plant sequence entries (including fungi and algae), part 435. 3415. gbpln436.seq - Plant sequence entries (including fungi and algae), part 436. 3416. gbpln437.seq - Plant sequence entries (including fungi and algae), part 437. 3417. gbpln438.seq - Plant sequence entries (including fungi and algae), part 438. 3418. gbpln439.seq - Plant sequence entries (including fungi and algae), part 439. 3419. gbpln44.seq - Plant sequence entries (including fungi and algae), part 44. 3420. gbpln440.seq - Plant sequence entries (including fungi and algae), part 440. 3421. gbpln441.seq - Plant sequence entries (including fungi and algae), part 441. 3422. gbpln442.seq - Plant sequence entries (including fungi and algae), part 442. 3423. gbpln443.seq - Plant sequence entries (including fungi and algae), part 443. 3424. gbpln444.seq - Plant sequence entries (including fungi and algae), part 444. 3425. gbpln445.seq - Plant sequence entries (including fungi and algae), part 445. 3426. gbpln446.seq - Plant sequence entries (including fungi and algae), part 446. 3427. gbpln447.seq - Plant sequence entries (including fungi and algae), part 447. 3428. gbpln448.seq - Plant sequence entries (including fungi and algae), part 448. 3429. gbpln449.seq - Plant sequence entries (including fungi and algae), part 449. 3430. gbpln45.seq - Plant sequence entries (including fungi and algae), part 45. 3431. gbpln450.seq - Plant sequence entries (including fungi and algae), part 450. 3432. gbpln451.seq - Plant sequence entries (including fungi and algae), part 451. 3433. gbpln452.seq - Plant sequence entries (including fungi and algae), part 452. 3434. gbpln453.seq - Plant sequence entries (including fungi and algae), part 453. 3435. gbpln454.seq - Plant sequence entries (including fungi and algae), part 454. 3436. gbpln455.seq - Plant sequence entries (including fungi and algae), part 455. 3437. gbpln456.seq - Plant sequence entries (including fungi and algae), part 456. 3438. gbpln457.seq - Plant sequence entries (including fungi and algae), part 457. 3439. gbpln458.seq - Plant sequence entries (including fungi and algae), part 458. 3440. gbpln459.seq - Plant sequence entries (including fungi and algae), part 459. 3441. gbpln46.seq - Plant sequence entries (including fungi and algae), part 46. 3442. gbpln460.seq - Plant sequence entries (including fungi and algae), part 460. 3443. gbpln461.seq - Plant sequence entries (including fungi and algae), part 461. 3444. gbpln462.seq - Plant sequence entries (including fungi and algae), part 462. 3445. gbpln463.seq - Plant sequence entries (including fungi and algae), part 463. 3446. gbpln464.seq - Plant sequence entries (including fungi and algae), part 464. 3447. gbpln465.seq - Plant sequence entries (including fungi and algae), part 465. 3448. gbpln466.seq - Plant sequence entries (including fungi and algae), part 466. 3449. gbpln467.seq - Plant sequence entries (including fungi and algae), part 467. 3450. gbpln468.seq - Plant sequence entries (including fungi and algae), part 468. 3451. gbpln469.seq - Plant sequence entries (including fungi and algae), part 469. 3452. gbpln47.seq - Plant sequence entries (including fungi and algae), part 47. 3453. gbpln470.seq - Plant sequence entries (including fungi and algae), part 470. 3454. gbpln471.seq - Plant sequence entries (including fungi and algae), part 471. 3455. gbpln472.seq - Plant sequence entries (including fungi and algae), part 472. 3456. gbpln473.seq - Plant sequence entries (including fungi and algae), part 473. 3457. gbpln474.seq - Plant sequence entries (including fungi and algae), part 474. 3458. gbpln475.seq - Plant sequence entries (including fungi and algae), part 475. 3459. gbpln476.seq - Plant sequence entries (including fungi and algae), part 476. 3460. gbpln477.seq - Plant sequence entries (including fungi and algae), part 477. 3461. gbpln478.seq - Plant sequence entries (including fungi and algae), part 478. 3462. gbpln479.seq - Plant sequence entries (including fungi and algae), part 479. 3463. gbpln48.seq - Plant sequence entries (including fungi and algae), part 48. 3464. gbpln480.seq - Plant sequence entries (including fungi and algae), part 480. 3465. gbpln481.seq - Plant sequence entries (including fungi and algae), part 481. 3466. gbpln482.seq - Plant sequence entries (including fungi and algae), part 482. 3467. gbpln483.seq - Plant sequence entries (including fungi and algae), part 483. 3468. gbpln484.seq - Plant sequence entries (including fungi and algae), part 484. 3469. gbpln485.seq - Plant sequence entries (including fungi and algae), part 485. 3470. gbpln486.seq - Plant sequence entries (including fungi and algae), part 486. 3471. gbpln487.seq - Plant sequence entries (including fungi and algae), part 487. 3472. gbpln488.seq - Plant sequence entries (including fungi and algae), part 488. 3473. gbpln489.seq - Plant sequence entries (including fungi and algae), part 489. 3474. gbpln49.seq - Plant sequence entries (including fungi and algae), part 49. 3475. gbpln490.seq - Plant sequence entries (including fungi and algae), part 490. 3476. gbpln491.seq - Plant sequence entries (including fungi and algae), part 491. 3477. gbpln492.seq - Plant sequence entries (including fungi and algae), part 492. 3478. gbpln493.seq - Plant sequence entries (including fungi and algae), part 493. 3479. gbpln494.seq - Plant sequence entries (including fungi and algae), part 494. 3480. gbpln495.seq - Plant sequence entries (including fungi and algae), part 495. 3481. gbpln496.seq - Plant sequence entries (including fungi and algae), part 496. 3482. gbpln497.seq - Plant sequence entries (including fungi and algae), part 497. 3483. gbpln498.seq - Plant sequence entries (including fungi and algae), part 498. 3484. gbpln499.seq - Plant sequence entries (including fungi and algae), part 499. 3485. gbpln5.seq - Plant sequence entries (including fungi and algae), part 5. 3486. gbpln50.seq - Plant sequence entries (including fungi and algae), part 50. 3487. gbpln500.seq - Plant sequence entries (including fungi and algae), part 500. 3488. gbpln501.seq - Plant sequence entries (including fungi and algae), part 501. 3489. gbpln502.seq - Plant sequence entries (including fungi and algae), part 502. 3490. gbpln503.seq - Plant sequence entries (including fungi and algae), part 503. 3491. gbpln504.seq - Plant sequence entries (including fungi and algae), part 504. 3492. gbpln505.seq - Plant sequence entries (including fungi and algae), part 505. 3493. gbpln506.seq - Plant sequence entries (including fungi and algae), part 506. 3494. gbpln507.seq - Plant sequence entries (including fungi and algae), part 507. 3495. gbpln508.seq - Plant sequence entries (including fungi and algae), part 508. 3496. gbpln509.seq - Plant sequence entries (including fungi and algae), part 509. 3497. gbpln51.seq - Plant sequence entries (including fungi and algae), part 51. 3498. gbpln510.seq - Plant sequence entries (including fungi and algae), part 510. 3499. gbpln511.seq - Plant sequence entries (including fungi and algae), part 511. 3500. gbpln512.seq - Plant sequence entries (including fungi and algae), part 512. 3501. gbpln513.seq - Plant sequence entries (including fungi and algae), part 513. 3502. gbpln514.seq - Plant sequence entries (including fungi and algae), part 514. 3503. gbpln515.seq - Plant sequence entries (including fungi and algae), part 515. 3504. gbpln516.seq - Plant sequence entries (including fungi and algae), part 516. 3505. gbpln517.seq - Plant sequence entries (including fungi and algae), part 517. 3506. gbpln518.seq - Plant sequence entries (including fungi and algae), part 518. 3507. gbpln519.seq - Plant sequence entries (including fungi and algae), part 519. 3508. gbpln52.seq - Plant sequence entries (including fungi and algae), part 52. 3509. gbpln520.seq - Plant sequence entries (including fungi and algae), part 520. 3510. gbpln521.seq - Plant sequence entries (including fungi and algae), part 521. 3511. gbpln522.seq - Plant sequence entries (including fungi and algae), part 522. 3512. gbpln523.seq - Plant sequence entries (including fungi and algae), part 523. 3513. gbpln524.seq - Plant sequence entries (including fungi and algae), part 524. 3514. gbpln525.seq - Plant sequence entries (including fungi and algae), part 525. 3515. gbpln526.seq - Plant sequence entries (including fungi and algae), part 526. 3516. gbpln527.seq - Plant sequence entries (including fungi and algae), part 527. 3517. gbpln528.seq - Plant sequence entries (including fungi and algae), part 528. 3518. gbpln529.seq - Plant sequence entries (including fungi and algae), part 529. 3519. gbpln53.seq - Plant sequence entries (including fungi and algae), part 53. 3520. gbpln530.seq - Plant sequence entries (including fungi and algae), part 530. 3521. gbpln531.seq - Plant sequence entries (including fungi and algae), part 531. 3522. gbpln532.seq - Plant sequence entries (including fungi and algae), part 532. 3523. gbpln533.seq - Plant sequence entries (including fungi and algae), part 533. 3524. gbpln534.seq - Plant sequence entries (including fungi and algae), part 534. 3525. gbpln535.seq - Plant sequence entries (including fungi and algae), part 535. 3526. gbpln536.seq - Plant sequence entries (including fungi and algae), part 536. 3527. gbpln537.seq - Plant sequence entries (including fungi and algae), part 537. 3528. gbpln538.seq - Plant sequence entries (including fungi and algae), part 538. 3529. gbpln539.seq - Plant sequence entries (including fungi and algae), part 539. 3530. gbpln54.seq - Plant sequence entries (including fungi and algae), part 54. 3531. gbpln540.seq - Plant sequence entries (including fungi and algae), part 540. 3532. gbpln541.seq - Plant sequence entries (including fungi and algae), part 541. 3533. gbpln542.seq - Plant sequence entries (including fungi and algae), part 542. 3534. gbpln543.seq - Plant sequence entries (including fungi and algae), part 543. 3535. gbpln544.seq - Plant sequence entries (including fungi and algae), part 544. 3536. gbpln545.seq - Plant sequence entries (including fungi and algae), part 545. 3537. gbpln546.seq - Plant sequence entries (including fungi and algae), part 546. 3538. gbpln547.seq - Plant sequence entries (including fungi and algae), part 547. 3539. gbpln548.seq - Plant sequence entries (including fungi and algae), part 548. 3540. gbpln549.seq - Plant sequence entries (including fungi and algae), part 549. 3541. gbpln55.seq - Plant sequence entries (including fungi and algae), part 55. 3542. gbpln550.seq - Plant sequence entries (including fungi and algae), part 550. 3543. gbpln551.seq - Plant sequence entries (including fungi and algae), part 551. 3544. gbpln552.seq - Plant sequence entries (including fungi and algae), part 552. 3545. gbpln553.seq - Plant sequence entries (including fungi and algae), part 553. 3546. gbpln554.seq - Plant sequence entries (including fungi and algae), part 554. 3547. gbpln555.seq - Plant sequence entries (including fungi and algae), part 555. 3548. gbpln556.seq - Plant sequence entries (including fungi and algae), part 556. 3549. gbpln557.seq - Plant sequence entries (including fungi and algae), part 557. 3550. gbpln558.seq - Plant sequence entries (including fungi and algae), part 558. 3551. gbpln559.seq - Plant sequence entries (including fungi and algae), part 559. 3552. gbpln56.seq - Plant sequence entries (including fungi and algae), part 56. 3553. gbpln560.seq - Plant sequence entries (including fungi and algae), part 560. 3554. gbpln561.seq - Plant sequence entries (including fungi and algae), part 561. 3555. gbpln562.seq - Plant sequence entries (including fungi and algae), part 562. 3556. gbpln563.seq - Plant sequence entries (including fungi and algae), part 563. 3557. gbpln564.seq - Plant sequence entries (including fungi and algae), part 564. 3558. gbpln565.seq - Plant sequence entries (including fungi and algae), part 565. 3559. gbpln566.seq - Plant sequence entries (including fungi and algae), part 566. 3560. gbpln567.seq - Plant sequence entries (including fungi and algae), part 567. 3561. gbpln568.seq - Plant sequence entries (including fungi and algae), part 568. 3562. gbpln569.seq - Plant sequence entries (including fungi and algae), part 569. 3563. gbpln57.seq - Plant sequence entries (including fungi and algae), part 57. 3564. gbpln570.seq - Plant sequence entries (including fungi and algae), part 570. 3565. gbpln571.seq - Plant sequence entries (including fungi and algae), part 571. 3566. gbpln572.seq - Plant sequence entries (including fungi and algae), part 572. 3567. gbpln573.seq - Plant sequence entries (including fungi and algae), part 573. 3568. gbpln574.seq - Plant sequence entries (including fungi and algae), part 574. 3569. gbpln575.seq - Plant sequence entries (including fungi and algae), part 575. 3570. gbpln576.seq - Plant sequence entries (including fungi and algae), part 576. 3571. gbpln577.seq - Plant sequence entries (including fungi and algae), part 577. 3572. gbpln578.seq - Plant sequence entries (including fungi and algae), part 578. 3573. gbpln579.seq - Plant sequence entries (including fungi and algae), part 579. 3574. gbpln58.seq - Plant sequence entries (including fungi and algae), part 58. 3575. gbpln580.seq - Plant sequence entries (including fungi and algae), part 580. 3576. gbpln581.seq - Plant sequence entries (including fungi and algae), part 581. 3577. gbpln582.seq - Plant sequence entries (including fungi and algae), part 582. 3578. gbpln583.seq - Plant sequence entries (including fungi and algae), part 583. 3579. gbpln584.seq - Plant sequence entries (including fungi and algae), part 584. 3580. gbpln585.seq - Plant sequence entries (including fungi and algae), part 585. 3581. gbpln586.seq - Plant sequence entries (including fungi and algae), part 586. 3582. gbpln587.seq - Plant sequence entries (including fungi and algae), part 587. 3583. gbpln588.seq - Plant sequence entries (including fungi and algae), part 588. 3584. gbpln589.seq - Plant sequence entries (including fungi and algae), part 589. 3585. gbpln59.seq - Plant sequence entries (including fungi and algae), part 59. 3586. gbpln590.seq - Plant sequence entries (including fungi and algae), part 590. 3587. gbpln591.seq - Plant sequence entries (including fungi and algae), part 591. 3588. gbpln592.seq - Plant sequence entries (including fungi and algae), part 592. 3589. gbpln593.seq - Plant sequence entries (including fungi and algae), part 593. 3590. gbpln594.seq - Plant sequence entries (including fungi and algae), part 594. 3591. gbpln595.seq - Plant sequence entries (including fungi and algae), part 595. 3592. gbpln596.seq - Plant sequence entries (including fungi and algae), part 596. 3593. gbpln597.seq - Plant sequence entries (including fungi and algae), part 597. 3594. gbpln598.seq - Plant sequence entries (including fungi and algae), part 598. 3595. gbpln599.seq - Plant sequence entries (including fungi and algae), part 599. 3596. gbpln6.seq - Plant sequence entries (including fungi and algae), part 6. 3597. gbpln60.seq - Plant sequence entries (including fungi and algae), part 60. 3598. gbpln600.seq - Plant sequence entries (including fungi and algae), part 600. 3599. gbpln601.seq - Plant sequence entries (including fungi and algae), part 601. 3600. gbpln602.seq - Plant sequence entries (including fungi and algae), part 602. 3601. gbpln603.seq - Plant sequence entries (including fungi and algae), part 603. 3602. gbpln604.seq - Plant sequence entries (including fungi and algae), part 604. 3603. gbpln605.seq - Plant sequence entries (including fungi and algae), part 605. 3604. gbpln606.seq - Plant sequence entries (including fungi and algae), part 606. 3605. gbpln607.seq - Plant sequence entries (including fungi and algae), part 607. 3606. gbpln608.seq - Plant sequence entries (including fungi and algae), part 608. 3607. gbpln609.seq - Plant sequence entries (including fungi and algae), part 609. 3608. gbpln61.seq - Plant sequence entries (including fungi and algae), part 61. 3609. gbpln610.seq - Plant sequence entries (including fungi and algae), part 610. 3610. gbpln611.seq - Plant sequence entries (including fungi and algae), part 611. 3611. gbpln612.seq - Plant sequence entries (including fungi and algae), part 612. 3612. gbpln613.seq - Plant sequence entries (including fungi and algae), part 613. 3613. gbpln614.seq - Plant sequence entries (including fungi and algae), part 614. 3614. gbpln615.seq - Plant sequence entries (including fungi and algae), part 615. 3615. gbpln616.seq - Plant sequence entries (including fungi and algae), part 616. 3616. gbpln617.seq - Plant sequence entries (including fungi and algae), part 617. 3617. gbpln618.seq - Plant sequence entries (including fungi and algae), part 618. 3618. gbpln619.seq - Plant sequence entries (including fungi and algae), part 619. 3619. gbpln62.seq - Plant sequence entries (including fungi and algae), part 62. 3620. gbpln620.seq - Plant sequence entries (including fungi and algae), part 620. 3621. gbpln621.seq - Plant sequence entries (including fungi and algae), part 621. 3622. gbpln622.seq - Plant sequence entries (including fungi and algae), part 622. 3623. gbpln623.seq - Plant sequence entries (including fungi and algae), part 623. 3624. gbpln624.seq - Plant sequence entries (including fungi and algae), part 624. 3625. gbpln625.seq - Plant sequence entries (including fungi and algae), part 625. 3626. gbpln626.seq - Plant sequence entries (including fungi and algae), part 626. 3627. gbpln627.seq - Plant sequence entries (including fungi and algae), part 627. 3628. gbpln628.seq - Plant sequence entries (including fungi and algae), part 628. 3629. gbpln629.seq - Plant sequence entries (including fungi and algae), part 629. 3630. gbpln63.seq - Plant sequence entries (including fungi and algae), part 63. 3631. gbpln630.seq - Plant sequence entries (including fungi and algae), part 630. 3632. gbpln631.seq - Plant sequence entries (including fungi and algae), part 631. 3633. gbpln632.seq - Plant sequence entries (including fungi and algae), part 632. 3634. gbpln633.seq - Plant sequence entries (including fungi and algae), part 633. 3635. gbpln634.seq - Plant sequence entries (including fungi and algae), part 634. 3636. gbpln635.seq - Plant sequence entries (including fungi and algae), part 635. 3637. gbpln636.seq - Plant sequence entries (including fungi and algae), part 636. 3638. gbpln637.seq - Plant sequence entries (including fungi and algae), part 637. 3639. gbpln638.seq - Plant sequence entries (including fungi and algae), part 638. 3640. gbpln639.seq - Plant sequence entries (including fungi and algae), part 639. 3641. gbpln64.seq - Plant sequence entries (including fungi and algae), part 64. 3642. gbpln640.seq - Plant sequence entries (including fungi and algae), part 640. 3643. gbpln641.seq - Plant sequence entries (including fungi and algae), part 641. 3644. gbpln642.seq - Plant sequence entries (including fungi and algae), part 642. 3645. gbpln643.seq - Plant sequence entries (including fungi and algae), part 643. 3646. gbpln644.seq - Plant sequence entries (including fungi and algae), part 644. 3647. gbpln645.seq - Plant sequence entries (including fungi and algae), part 645. 3648. gbpln646.seq - Plant sequence entries (including fungi and algae), part 646. 3649. gbpln647.seq - Plant sequence entries (including fungi and algae), part 647. 3650. gbpln648.seq - Plant sequence entries (including fungi and algae), part 648. 3651. gbpln649.seq - Plant sequence entries (including fungi and algae), part 649. 3652. gbpln65.seq - Plant sequence entries (including fungi and algae), part 65. 3653. gbpln650.seq - Plant sequence entries (including fungi and algae), part 650. 3654. gbpln651.seq - Plant sequence entries (including fungi and algae), part 651. 3655. gbpln652.seq - Plant sequence entries (including fungi and algae), part 652. 3656. gbpln653.seq - Plant sequence entries (including fungi and algae), part 653. 3657. gbpln654.seq - Plant sequence entries (including fungi and algae), part 654. 3658. gbpln655.seq - Plant sequence entries (including fungi and algae), part 655. 3659. gbpln656.seq - Plant sequence entries (including fungi and algae), part 656. 3660. gbpln657.seq - Plant sequence entries (including fungi and algae), part 657. 3661. gbpln658.seq - Plant sequence entries (including fungi and algae), part 658. 3662. gbpln659.seq - Plant sequence entries (including fungi and algae), part 659. 3663. gbpln66.seq - Plant sequence entries (including fungi and algae), part 66. 3664. gbpln660.seq - Plant sequence entries (including fungi and algae), part 660. 3665. gbpln661.seq - Plant sequence entries (including fungi and algae), part 661. 3666. gbpln662.seq - Plant sequence entries (including fungi and algae), part 662. 3667. gbpln663.seq - Plant sequence entries (including fungi and algae), part 663. 3668. gbpln664.seq - Plant sequence entries (including fungi and algae), part 664. 3669. gbpln665.seq - Plant sequence entries (including fungi and algae), part 665. 3670. gbpln666.seq - Plant sequence entries (including fungi and algae), part 666. 3671. gbpln667.seq - Plant sequence entries (including fungi and algae), part 667. 3672. gbpln668.seq - Plant sequence entries (including fungi and algae), part 668. 3673. gbpln669.seq - Plant sequence entries (including fungi and algae), part 669. 3674. gbpln67.seq - Plant sequence entries (including fungi and algae), part 67. 3675. gbpln670.seq - Plant sequence entries (including fungi and algae), part 670. 3676. gbpln671.seq - Plant sequence entries (including fungi and algae), part 671. 3677. gbpln672.seq - Plant sequence entries (including fungi and algae), part 672. 3678. gbpln673.seq - Plant sequence entries (including fungi and algae), part 673. 3679. gbpln674.seq - Plant sequence entries (including fungi and algae), part 674. 3680. gbpln675.seq - Plant sequence entries (including fungi and algae), part 675. 3681. gbpln676.seq - Plant sequence entries (including fungi and algae), part 676. 3682. gbpln677.seq - Plant sequence entries (including fungi and algae), part 677. 3683. gbpln678.seq - Plant sequence entries (including fungi and algae), part 678. 3684. gbpln679.seq - Plant sequence entries (including fungi and algae), part 679. 3685. gbpln68.seq - Plant sequence entries (including fungi and algae), part 68. 3686. gbpln680.seq - Plant sequence entries (including fungi and algae), part 680. 3687. gbpln681.seq - Plant sequence entries (including fungi and algae), part 681. 3688. gbpln682.seq - Plant sequence entries (including fungi and algae), part 682. 3689. gbpln683.seq - Plant sequence entries (including fungi and algae), part 683. 3690. gbpln684.seq - Plant sequence entries (including fungi and algae), part 684. 3691. gbpln685.seq - Plant sequence entries (including fungi and algae), part 685. 3692. gbpln686.seq - Plant sequence entries (including fungi and algae), part 686. 3693. gbpln687.seq - Plant sequence entries (including fungi and algae), part 687. 3694. gbpln688.seq - Plant sequence entries (including fungi and algae), part 688. 3695. gbpln689.seq - Plant sequence entries (including fungi and algae), part 689. 3696. gbpln69.seq - Plant sequence entries (including fungi and algae), part 69. 3697. gbpln690.seq - Plant sequence entries (including fungi and algae), part 690. 3698. gbpln691.seq - Plant sequence entries (including fungi and algae), part 691. 3699. gbpln692.seq - Plant sequence entries (including fungi and algae), part 692. 3700. gbpln693.seq - Plant sequence entries (including fungi and algae), part 693. 3701. gbpln694.seq - Plant sequence entries (including fungi and algae), part 694. 3702. gbpln695.seq - Plant sequence entries (including fungi and algae), part 695. 3703. gbpln696.seq - Plant sequence entries (including fungi and algae), part 696. 3704. gbpln697.seq - Plant sequence entries (including fungi and algae), part 697. 3705. gbpln698.seq - Plant sequence entries (including fungi and algae), part 698. 3706. gbpln699.seq - Plant sequence entries (including fungi and algae), part 699. 3707. gbpln7.seq - Plant sequence entries (including fungi and algae), part 7. 3708. gbpln70.seq - Plant sequence entries (including fungi and algae), part 70. 3709. gbpln700.seq - Plant sequence entries (including fungi and algae), part 700. 3710. gbpln701.seq - Plant sequence entries (including fungi and algae), part 701. 3711. gbpln702.seq - Plant sequence entries (including fungi and algae), part 702. 3712. gbpln703.seq - Plant sequence entries (including fungi and algae), part 703. 3713. gbpln704.seq - Plant sequence entries (including fungi and algae), part 704. 3714. gbpln705.seq - Plant sequence entries (including fungi and algae), part 705. 3715. gbpln706.seq - Plant sequence entries (including fungi and algae), part 706. 3716. gbpln707.seq - Plant sequence entries (including fungi and algae), part 707. 3717. gbpln708.seq - Plant sequence entries (including fungi and algae), part 708. 3718. gbpln709.seq - Plant sequence entries (including fungi and algae), part 709. 3719. gbpln71.seq - Plant sequence entries (including fungi and algae), part 71. 3720. gbpln710.seq - Plant sequence entries (including fungi and algae), part 710. 3721. gbpln711.seq - Plant sequence entries (including fungi and algae), part 711. 3722. gbpln712.seq - Plant sequence entries (including fungi and algae), part 712. 3723. gbpln713.seq - Plant sequence entries (including fungi and algae), part 713. 3724. gbpln714.seq - Plant sequence entries (including fungi and algae), part 714. 3725. gbpln715.seq - Plant sequence entries (including fungi and algae), part 715. 3726. gbpln716.seq - Plant sequence entries (including fungi and algae), part 716. 3727. gbpln717.seq - Plant sequence entries (including fungi and algae), part 717. 3728. gbpln718.seq - Plant sequence entries (including fungi and algae), part 718. 3729. gbpln719.seq - Plant sequence entries (including fungi and algae), part 719. 3730. gbpln72.seq - Plant sequence entries (including fungi and algae), part 72. 3731. gbpln720.seq - Plant sequence entries (including fungi and algae), part 720. 3732. gbpln721.seq - Plant sequence entries (including fungi and algae), part 721. 3733. gbpln722.seq - Plant sequence entries (including fungi and algae), part 722. 3734. gbpln723.seq - Plant sequence entries (including fungi and algae), part 723. 3735. gbpln724.seq - Plant sequence entries (including fungi and algae), part 724. 3736. gbpln725.seq - Plant sequence entries (including fungi and algae), part 725. 3737. gbpln726.seq - Plant sequence entries (including fungi and algae), part 726. 3738. gbpln727.seq - Plant sequence entries (including fungi and algae), part 727. 3739. gbpln728.seq - Plant sequence entries (including fungi and algae), part 728. 3740. gbpln729.seq - Plant sequence entries (including fungi and algae), part 729. 3741. gbpln73.seq - Plant sequence entries (including fungi and algae), part 73. 3742. gbpln730.seq - Plant sequence entries (including fungi and algae), part 730. 3743. gbpln731.seq - Plant sequence entries (including fungi and algae), part 731. 3744. gbpln732.seq - Plant sequence entries (including fungi and algae), part 732. 3745. gbpln733.seq - Plant sequence entries (including fungi and algae), part 733. 3746. gbpln734.seq - Plant sequence entries (including fungi and algae), part 734. 3747. gbpln735.seq - Plant sequence entries (including fungi and algae), part 735. 3748. gbpln736.seq - Plant sequence entries (including fungi and algae), part 736. 3749. gbpln737.seq - Plant sequence entries (including fungi and algae), part 737. 3750. gbpln738.seq - Plant sequence entries (including fungi and algae), part 738. 3751. gbpln739.seq - Plant sequence entries (including fungi and algae), part 739. 3752. gbpln74.seq - Plant sequence entries (including fungi and algae), part 74. 3753. gbpln740.seq - Plant sequence entries (including fungi and algae), part 740. 3754. gbpln741.seq - Plant sequence entries (including fungi and algae), part 741. 3755. gbpln742.seq - Plant sequence entries (including fungi and algae), part 742. 3756. gbpln743.seq - Plant sequence entries (including fungi and algae), part 743. 3757. gbpln744.seq - Plant sequence entries (including fungi and algae), part 744. 3758. gbpln745.seq - Plant sequence entries (including fungi and algae), part 745. 3759. gbpln746.seq - Plant sequence entries (including fungi and algae), part 746. 3760. gbpln747.seq - Plant sequence entries (including fungi and algae), part 747. 3761. gbpln748.seq - Plant sequence entries (including fungi and algae), part 748. 3762. gbpln749.seq - Plant sequence entries (including fungi and algae), part 749. 3763. gbpln75.seq - Plant sequence entries (including fungi and algae), part 75. 3764. gbpln750.seq - Plant sequence entries (including fungi and algae), part 750. 3765. gbpln751.seq - Plant sequence entries (including fungi and algae), part 751. 3766. gbpln752.seq - Plant sequence entries (including fungi and algae), part 752. 3767. gbpln753.seq - Plant sequence entries (including fungi and algae), part 753. 3768. gbpln754.seq - Plant sequence entries (including fungi and algae), part 754. 3769. gbpln755.seq - Plant sequence entries (including fungi and algae), part 755. 3770. gbpln756.seq - Plant sequence entries (including fungi and algae), part 756. 3771. gbpln757.seq - Plant sequence entries (including fungi and algae), part 757. 3772. gbpln758.seq - Plant sequence entries (including fungi and algae), part 758. 3773. gbpln759.seq - Plant sequence entries (including fungi and algae), part 759. 3774. gbpln76.seq - Plant sequence entries (including fungi and algae), part 76. 3775. gbpln760.seq - Plant sequence entries (including fungi and algae), part 760. 3776. gbpln761.seq - Plant sequence entries (including fungi and algae), part 761. 3777. gbpln762.seq - Plant sequence entries (including fungi and algae), part 762. 3778. gbpln763.seq - Plant sequence entries (including fungi and algae), part 763. 3779. gbpln764.seq - Plant sequence entries (including fungi and algae), part 764. 3780. gbpln765.seq - Plant sequence entries (including fungi and algae), part 765. 3781. gbpln766.seq - Plant sequence entries (including fungi and algae), part 766. 3782. gbpln767.seq - Plant sequence entries (including fungi and algae), part 767. 3783. gbpln768.seq - Plant sequence entries (including fungi and algae), part 768. 3784. gbpln769.seq - Plant sequence entries (including fungi and algae), part 769. 3785. gbpln77.seq - Plant sequence entries (including fungi and algae), part 77. 3786. gbpln770.seq - Plant sequence entries (including fungi and algae), part 770. 3787. gbpln771.seq - Plant sequence entries (including fungi and algae), part 771. 3788. gbpln772.seq - Plant sequence entries (including fungi and algae), part 772. 3789. gbpln773.seq - Plant sequence entries (including fungi and algae), part 773. 3790. gbpln774.seq - Plant sequence entries (including fungi and algae), part 774. 3791. gbpln775.seq - Plant sequence entries (including fungi and algae), part 775. 3792. gbpln776.seq - Plant sequence entries (including fungi and algae), part 776. 3793. gbpln777.seq - Plant sequence entries (including fungi and algae), part 777. 3794. gbpln778.seq - Plant sequence entries (including fungi and algae), part 778. 3795. gbpln779.seq - Plant sequence entries (including fungi and algae), part 779. 3796. gbpln78.seq - Plant sequence entries (including fungi and algae), part 78. 3797. gbpln780.seq - Plant sequence entries (including fungi and algae), part 780. 3798. gbpln781.seq - Plant sequence entries (including fungi and algae), part 781. 3799. gbpln782.seq - Plant sequence entries (including fungi and algae), part 782. 3800. gbpln783.seq - Plant sequence entries (including fungi and algae), part 783. 3801. gbpln784.seq - Plant sequence entries (including fungi and algae), part 784. 3802. gbpln785.seq - Plant sequence entries (including fungi and algae), part 785. 3803. gbpln786.seq - Plant sequence entries (including fungi and algae), part 786. 3804. gbpln787.seq - Plant sequence entries (including fungi and algae), part 787. 3805. gbpln788.seq - Plant sequence entries (including fungi and algae), part 788. 3806. gbpln789.seq - Plant sequence entries (including fungi and algae), part 789. 3807. gbpln79.seq - Plant sequence entries (including fungi and algae), part 79. 3808. gbpln790.seq - Plant sequence entries (including fungi and algae), part 790. 3809. gbpln791.seq - Plant sequence entries (including fungi and algae), part 791. 3810. gbpln792.seq - Plant sequence entries (including fungi and algae), part 792. 3811. gbpln793.seq - Plant sequence entries (including fungi and algae), part 793. 3812. gbpln794.seq - Plant sequence entries (including fungi and algae), part 794. 3813. gbpln795.seq - Plant sequence entries (including fungi and algae), part 795. 3814. gbpln796.seq - Plant sequence entries (including fungi and algae), part 796. 3815. gbpln797.seq - Plant sequence entries (including fungi and algae), part 797. 3816. gbpln798.seq - Plant sequence entries (including fungi and algae), part 798. 3817. gbpln799.seq - Plant sequence entries (including fungi and algae), part 799. 3818. gbpln8.seq - Plant sequence entries (including fungi and algae), part 8. 3819. gbpln80.seq - Plant sequence entries (including fungi and algae), part 80. 3820. gbpln800.seq - Plant sequence entries (including fungi and algae), part 800. 3821. gbpln801.seq - Plant sequence entries (including fungi and algae), part 801. 3822. gbpln802.seq - Plant sequence entries (including fungi and algae), part 802. 3823. gbpln803.seq - Plant sequence entries (including fungi and algae), part 803. 3824. gbpln804.seq - Plant sequence entries (including fungi and algae), part 804. 3825. gbpln805.seq - Plant sequence entries (including fungi and algae), part 805. 3826. gbpln806.seq - Plant sequence entries (including fungi and algae), part 806. 3827. gbpln807.seq - Plant sequence entries (including fungi and algae), part 807. 3828. gbpln808.seq - Plant sequence entries (including fungi and algae), part 808. 3829. gbpln809.seq - Plant sequence entries (including fungi and algae), part 809. 3830. gbpln81.seq - Plant sequence entries (including fungi and algae), part 81. 3831. gbpln810.seq - Plant sequence entries (including fungi and algae), part 810. 3832. gbpln811.seq - Plant sequence entries (including fungi and algae), part 811. 3833. gbpln812.seq - Plant sequence entries (including fungi and algae), part 812. 3834. gbpln813.seq - Plant sequence entries (including fungi and algae), part 813. 3835. gbpln814.seq - Plant sequence entries (including fungi and algae), part 814. 3836. gbpln815.seq - Plant sequence entries (including fungi and algae), part 815. 3837. gbpln816.seq - Plant sequence entries (including fungi and algae), part 816. 3838. gbpln817.seq - Plant sequence entries (including fungi and algae), part 817. 3839. gbpln818.seq - Plant sequence entries (including fungi and algae), part 818. 3840. gbpln819.seq - Plant sequence entries (including fungi and algae), part 819. 3841. gbpln82.seq - Plant sequence entries (including fungi and algae), part 82. 3842. gbpln820.seq - Plant sequence entries (including fungi and algae), part 820. 3843. gbpln821.seq - Plant sequence entries (including fungi and algae), part 821. 3844. gbpln822.seq - Plant sequence entries (including fungi and algae), part 822. 3845. gbpln823.seq - Plant sequence entries (including fungi and algae), part 823. 3846. gbpln824.seq - Plant sequence entries (including fungi and algae), part 824. 3847. gbpln825.seq - Plant sequence entries (including fungi and algae), part 825. 3848. gbpln826.seq - Plant sequence entries (including fungi and algae), part 826. 3849. gbpln827.seq - Plant sequence entries (including fungi and algae), part 827. 3850. gbpln828.seq - Plant sequence entries (including fungi and algae), part 828. 3851. gbpln829.seq - Plant sequence entries (including fungi and algae), part 829. 3852. gbpln83.seq - Plant sequence entries (including fungi and algae), part 83. 3853. gbpln830.seq - Plant sequence entries (including fungi and algae), part 830. 3854. gbpln831.seq - Plant sequence entries (including fungi and algae), part 831. 3855. gbpln832.seq - Plant sequence entries (including fungi and algae), part 832. 3856. gbpln833.seq - Plant sequence entries (including fungi and algae), part 833. 3857. gbpln834.seq - Plant sequence entries (including fungi and algae), part 834. 3858. gbpln835.seq - Plant sequence entries (including fungi and algae), part 835. 3859. gbpln836.seq - Plant sequence entries (including fungi and algae), part 836. 3860. gbpln837.seq - Plant sequence entries (including fungi and algae), part 837. 3861. gbpln838.seq - Plant sequence entries (including fungi and algae), part 838. 3862. gbpln839.seq - Plant sequence entries (including fungi and algae), part 839. 3863. gbpln84.seq - Plant sequence entries (including fungi and algae), part 84. 3864. gbpln840.seq - Plant sequence entries (including fungi and algae), part 840. 3865. gbpln841.seq - Plant sequence entries (including fungi and algae), part 841. 3866. gbpln842.seq - Plant sequence entries (including fungi and algae), part 842. 3867. gbpln843.seq - Plant sequence entries (including fungi and algae), part 843. 3868. gbpln844.seq - Plant sequence entries (including fungi and algae), part 844. 3869. gbpln845.seq - Plant sequence entries (including fungi and algae), part 845. 3870. gbpln846.seq - Plant sequence entries (including fungi and algae), part 846. 3871. gbpln847.seq - Plant sequence entries (including fungi and algae), part 847. 3872. gbpln848.seq - Plant sequence entries (including fungi and algae), part 848. 3873. gbpln849.seq - Plant sequence entries (including fungi and algae), part 849. 3874. gbpln85.seq - Plant sequence entries (including fungi and algae), part 85. 3875. gbpln850.seq - Plant sequence entries (including fungi and algae), part 850. 3876. gbpln851.seq - Plant sequence entries (including fungi and algae), part 851. 3877. gbpln852.seq - Plant sequence entries (including fungi and algae), part 852. 3878. gbpln853.seq - Plant sequence entries (including fungi and algae), part 853. 3879. gbpln854.seq - Plant sequence entries (including fungi and algae), part 854. 3880. gbpln855.seq - Plant sequence entries (including fungi and algae), part 855. 3881. gbpln856.seq - Plant sequence entries (including fungi and algae), part 856. 3882. gbpln857.seq - Plant sequence entries (including fungi and algae), part 857. 3883. gbpln858.seq - Plant sequence entries (including fungi and algae), part 858. 3884. gbpln859.seq - Plant sequence entries (including fungi and algae), part 859. 3885. gbpln86.seq - Plant sequence entries (including fungi and algae), part 86. 3886. gbpln860.seq - Plant sequence entries (including fungi and algae), part 860. 3887. gbpln861.seq - Plant sequence entries (including fungi and algae), part 861. 3888. gbpln862.seq - Plant sequence entries (including fungi and algae), part 862. 3889. gbpln863.seq - Plant sequence entries (including fungi and algae), part 863. 3890. gbpln864.seq - Plant sequence entries (including fungi and algae), part 864. 3891. gbpln865.seq - Plant sequence entries (including fungi and algae), part 865. 3892. gbpln866.seq - Plant sequence entries (including fungi and algae), part 866. 3893. gbpln867.seq - Plant sequence entries (including fungi and algae), part 867. 3894. gbpln868.seq - Plant sequence entries (including fungi and algae), part 868. 3895. gbpln869.seq - Plant sequence entries (including fungi and algae), part 869. 3896. gbpln87.seq - Plant sequence entries (including fungi and algae), part 87. 3897. gbpln870.seq - Plant sequence entries (including fungi and algae), part 870. 3898. gbpln871.seq - Plant sequence entries (including fungi and algae), part 871. 3899. gbpln872.seq - Plant sequence entries (including fungi and algae), part 872. 3900. gbpln873.seq - Plant sequence entries (including fungi and algae), part 873. 3901. gbpln874.seq - Plant sequence entries (including fungi and algae), part 874. 3902. gbpln875.seq - Plant sequence entries (including fungi and algae), part 875. 3903. gbpln876.seq - Plant sequence entries (including fungi and algae), part 876. 3904. gbpln877.seq - Plant sequence entries (including fungi and algae), part 877. 3905. gbpln878.seq - Plant sequence entries (including fungi and algae), part 878. 3906. gbpln879.seq - Plant sequence entries (including fungi and algae), part 879. 3907. gbpln88.seq - Plant sequence entries (including fungi and algae), part 88. 3908. gbpln880.seq - Plant sequence entries (including fungi and algae), part 880. 3909. gbpln881.seq - Plant sequence entries (including fungi and algae), part 881. 3910. gbpln882.seq - Plant sequence entries (including fungi and algae), part 882. 3911. gbpln883.seq - Plant sequence entries (including fungi and algae), part 883. 3912. gbpln884.seq - Plant sequence entries (including fungi and algae), part 884. 3913. gbpln885.seq - Plant sequence entries (including fungi and algae), part 885. 3914. gbpln886.seq - Plant sequence entries (including fungi and algae), part 886. 3915. gbpln887.seq - Plant sequence entries (including fungi and algae), part 887. 3916. gbpln888.seq - Plant sequence entries (including fungi and algae), part 888. 3917. gbpln889.seq - Plant sequence entries (including fungi and algae), part 889. 3918. gbpln89.seq - Plant sequence entries (including fungi and algae), part 89. 3919. gbpln890.seq - Plant sequence entries (including fungi and algae), part 890. 3920. gbpln891.seq - Plant sequence entries (including fungi and algae), part 891. 3921. gbpln892.seq - Plant sequence entries (including fungi and algae), part 892. 3922. gbpln893.seq - Plant sequence entries (including fungi and algae), part 893. 3923. gbpln894.seq - Plant sequence entries (including fungi and algae), part 894. 3924. gbpln895.seq - Plant sequence entries (including fungi and algae), part 895. 3925. gbpln896.seq - Plant sequence entries (including fungi and algae), part 896. 3926. gbpln897.seq - Plant sequence entries (including fungi and algae), part 897. 3927. gbpln898.seq - Plant sequence entries (including fungi and algae), part 898. 3928. gbpln899.seq - Plant sequence entries (including fungi and algae), part 899. 3929. gbpln9.seq - Plant sequence entries (including fungi and algae), part 9. 3930. gbpln90.seq - Plant sequence entries (including fungi and algae), part 90. 3931. gbpln900.seq - Plant sequence entries (including fungi and algae), part 900. 3932. gbpln901.seq - Plant sequence entries (including fungi and algae), part 901. 3933. gbpln902.seq - Plant sequence entries (including fungi and algae), part 902. 3934. gbpln903.seq - Plant sequence entries (including fungi and algae), part 903. 3935. gbpln904.seq - Plant sequence entries (including fungi and algae), part 904. 3936. gbpln905.seq - Plant sequence entries (including fungi and algae), part 905. 3937. gbpln906.seq - Plant sequence entries (including fungi and algae), part 906. 3938. gbpln907.seq - Plant sequence entries (including fungi and algae), part 907. 3939. gbpln908.seq - Plant sequence entries (including fungi and algae), part 908. 3940. gbpln909.seq - Plant sequence entries (including fungi and algae), part 909. 3941. gbpln91.seq - Plant sequence entries (including fungi and algae), part 91. 3942. gbpln910.seq - Plant sequence entries (including fungi and algae), part 910. 3943. gbpln911.seq - Plant sequence entries (including fungi and algae), part 911. 3944. gbpln912.seq - Plant sequence entries (including fungi and algae), part 912. 3945. gbpln913.seq - Plant sequence entries (including fungi and algae), part 913. 3946. gbpln914.seq - Plant sequence entries (including fungi and algae), part 914. 3947. gbpln915.seq - Plant sequence entries (including fungi and algae), part 915. 3948. gbpln916.seq - Plant sequence entries (including fungi and algae), part 916. 3949. gbpln917.seq - Plant sequence entries (including fungi and algae), part 917. 3950. gbpln918.seq - Plant sequence entries (including fungi and algae), part 918. 3951. gbpln919.seq - Plant sequence entries (including fungi and algae), part 919. 3952. gbpln92.seq - Plant sequence entries (including fungi and algae), part 92. 3953. gbpln920.seq - Plant sequence entries (including fungi and algae), part 920. 3954. gbpln921.seq - Plant sequence entries (including fungi and algae), part 921. 3955. gbpln922.seq - Plant sequence entries (including fungi and algae), part 922. 3956. gbpln923.seq - Plant sequence entries (including fungi and algae), part 923. 3957. gbpln924.seq - Plant sequence entries (including fungi and algae), part 924. 3958. gbpln925.seq - Plant sequence entries (including fungi and algae), part 925. 3959. gbpln926.seq - Plant sequence entries (including fungi and algae), part 926. 3960. gbpln927.seq - Plant sequence entries (including fungi and algae), part 927. 3961. gbpln928.seq - Plant sequence entries (including fungi and algae), part 928. 3962. gbpln929.seq - Plant sequence entries (including fungi and algae), part 929. 3963. gbpln93.seq - Plant sequence entries (including fungi and algae), part 93. 3964. gbpln930.seq - Plant sequence entries (including fungi and algae), part 930. 3965. gbpln931.seq - Plant sequence entries (including fungi and algae), part 931. 3966. gbpln932.seq - Plant sequence entries (including fungi and algae), part 932. 3967. gbpln933.seq - Plant sequence entries (including fungi and algae), part 933. 3968. gbpln934.seq - Plant sequence entries (including fungi and algae), part 934. 3969. gbpln935.seq - Plant sequence entries (including fungi and algae), part 935. 3970. gbpln936.seq - Plant sequence entries (including fungi and algae), part 936. 3971. gbpln937.seq - Plant sequence entries (including fungi and algae), part 937. 3972. gbpln938.seq - Plant sequence entries (including fungi and algae), part 938. 3973. gbpln939.seq - Plant sequence entries (including fungi and algae), part 939. 3974. gbpln94.seq - Plant sequence entries (including fungi and algae), part 94. 3975. gbpln940.seq - Plant sequence entries (including fungi and algae), part 940. 3976. gbpln941.seq - Plant sequence entries (including fungi and algae), part 941. 3977. gbpln942.seq - Plant sequence entries (including fungi and algae), part 942. 3978. gbpln943.seq - Plant sequence entries (including fungi and algae), part 943. 3979. gbpln944.seq - Plant sequence entries (including fungi and algae), part 944. 3980. gbpln945.seq - Plant sequence entries (including fungi and algae), part 945. 3981. gbpln946.seq - Plant sequence entries (including fungi and algae), part 946. 3982. gbpln947.seq - Plant sequence entries (including fungi and algae), part 947. 3983. gbpln948.seq - Plant sequence entries (including fungi and algae), part 948. 3984. gbpln949.seq - Plant sequence entries (including fungi and algae), part 949. 3985. gbpln95.seq - Plant sequence entries (including fungi and algae), part 95. 3986. gbpln950.seq - Plant sequence entries (including fungi and algae), part 950. 3987. gbpln951.seq - Plant sequence entries (including fungi and algae), part 951. 3988. gbpln952.seq - Plant sequence entries (including fungi and algae), part 952. 3989. gbpln953.seq - Plant sequence entries (including fungi and algae), part 953. 3990. gbpln954.seq - Plant sequence entries (including fungi and algae), part 954. 3991. gbpln955.seq - Plant sequence entries (including fungi and algae), part 955. 3992. gbpln956.seq - Plant sequence entries (including fungi and algae), part 956. 3993. gbpln957.seq - Plant sequence entries (including fungi and algae), part 957. 3994. gbpln958.seq - Plant sequence entries (including fungi and algae), part 958. 3995. gbpln959.seq - Plant sequence entries (including fungi and algae), part 959. 3996. gbpln96.seq - Plant sequence entries (including fungi and algae), part 96. 3997. gbpln960.seq - Plant sequence entries (including fungi and algae), part 960. 3998. gbpln961.seq - Plant sequence entries (including fungi and algae), part 961. 3999. gbpln962.seq - Plant sequence entries (including fungi and algae), part 962. 4000. gbpln963.seq - Plant sequence entries (including fungi and algae), part 963. 4001. gbpln964.seq - Plant sequence entries (including fungi and algae), part 964. 4002. gbpln965.seq - Plant sequence entries (including fungi and algae), part 965. 4003. gbpln966.seq - Plant sequence entries (including fungi and algae), part 966. 4004. gbpln967.seq - Plant sequence entries (including fungi and algae), part 967. 4005. gbpln968.seq - Plant sequence entries (including fungi and algae), part 968. 4006. gbpln969.seq - Plant sequence entries (including fungi and algae), part 969. 4007. gbpln97.seq - Plant sequence entries (including fungi and algae), part 97. 4008. gbpln970.seq - Plant sequence entries (including fungi and algae), part 970. 4009. gbpln971.seq - Plant sequence entries (including fungi and algae), part 971. 4010. gbpln972.seq - Plant sequence entries (including fungi and algae), part 972. 4011. gbpln973.seq - Plant sequence entries (including fungi and algae), part 973. 4012. gbpln974.seq - Plant sequence entries (including fungi and algae), part 974. 4013. gbpln975.seq - Plant sequence entries (including fungi and algae), part 975. 4014. gbpln976.seq - Plant sequence entries (including fungi and algae), part 976. 4015. gbpln977.seq - Plant sequence entries (including fungi and algae), part 977. 4016. gbpln978.seq - Plant sequence entries (including fungi and algae), part 978. 4017. gbpln979.seq - Plant sequence entries (including fungi and algae), part 979. 4018. gbpln98.seq - Plant sequence entries (including fungi and algae), part 98. 4019. gbpln980.seq - Plant sequence entries (including fungi and algae), part 980. 4020. gbpln981.seq - Plant sequence entries (including fungi and algae), part 981. 4021. gbpln982.seq - Plant sequence entries (including fungi and algae), part 982. 4022. gbpln983.seq - Plant sequence entries (including fungi and algae), part 983. 4023. gbpln984.seq - Plant sequence entries (including fungi and algae), part 984. 4024. gbpln985.seq - Plant sequence entries (including fungi and algae), part 985. 4025. gbpln986.seq - Plant sequence entries (including fungi and algae), part 986. 4026. gbpln987.seq - Plant sequence entries (including fungi and algae), part 987. 4027. gbpln988.seq - Plant sequence entries (including fungi and algae), part 988. 4028. gbpln989.seq - Plant sequence entries (including fungi and algae), part 989. 4029. gbpln99.seq - Plant sequence entries (including fungi and algae), part 99. 4030. gbpln990.seq - Plant sequence entries (including fungi and algae), part 990. 4031. gbpln991.seq - Plant sequence entries (including fungi and algae), part 991. 4032. gbpln992.seq - Plant sequence entries (including fungi and algae), part 992. 4033. gbpln993.seq - Plant sequence entries (including fungi and algae), part 993. 4034. gbpln994.seq - Plant sequence entries (including fungi and algae), part 994. 4035. gbpln995.seq - Plant sequence entries (including fungi and algae), part 995. 4036. gbpln996.seq - Plant sequence entries (including fungi and algae), part 996. 4037. gbpln997.seq - Plant sequence entries (including fungi and algae), part 997. 4038. gbpln998.seq - Plant sequence entries (including fungi and algae), part 998. 4039. gbpln999.seq - Plant sequence entries (including fungi and algae), part 999. 4040. gbpri1.seq - Primate sequence entries, part 1. 4041. gbpri10.seq - Primate sequence entries, part 10. 4042. gbpri11.seq - Primate sequence entries, part 11. 4043. gbpri12.seq - Primate sequence entries, part 12. 4044. gbpri13.seq - Primate sequence entries, part 13. 4045. gbpri14.seq - Primate sequence entries, part 14. 4046. gbpri15.seq - Primate sequence entries, part 15. 4047. gbpri16.seq - Primate sequence entries, part 16. 4048. gbpri17.seq - Primate sequence entries, part 17. 4049. gbpri18.seq - Primate sequence entries, part 18. 4050. gbpri19.seq - Primate sequence entries, part 19. 4051. gbpri2.seq - Primate sequence entries, part 2. 4052. gbpri20.seq - Primate sequence entries, part 20. 4053. gbpri21.seq - Primate sequence entries, part 21. 4054. gbpri22.seq - Primate sequence entries, part 22. 4055. gbpri23.seq - Primate sequence entries, part 23. 4056. gbpri24.seq - Primate sequence entries, part 24. 4057. gbpri25.seq - Primate sequence entries, part 25. 4058. gbpri26.seq - Primate sequence entries, part 26. 4059. gbpri27.seq - Primate sequence entries, part 27. 4060. gbpri28.seq - Primate sequence entries, part 28. 4061. gbpri29.seq - Primate sequence entries, part 29. 4062. gbpri3.seq - Primate sequence entries, part 3. 4063. gbpri30.seq - Primate sequence entries, part 30. 4064. gbpri31.seq - Primate sequence entries, part 31. 4065. gbpri32.seq - Primate sequence entries, part 32. 4066. gbpri33.seq - Primate sequence entries, part 33. 4067. gbpri34.seq - Primate sequence entries, part 34. 4068. gbpri35.seq - Primate sequence entries, part 35. 4069. gbpri4.seq - Primate sequence entries, part 4. 4070. gbpri5.seq - Primate sequence entries, part 5. 4071. gbpri6.seq - Primate sequence entries, part 6. 4072. gbpri7.seq - Primate sequence entries, part 7. 4073. gbpri8.seq - Primate sequence entries, part 8. 4074. gbpri9.seq - Primate sequence entries, part 9. 4075. gbrel.txt - Release notes (this document). 4076. gbrod1.seq - Rodent sequence entries, part 1. 4077. gbrod10.seq - Rodent sequence entries, part 10. 4078. gbrod100.seq - Rodent sequence entries, part 100. 4079. gbrod101.seq - Rodent sequence entries, part 101. 4080. gbrod102.seq - Rodent sequence entries, part 102. 4081. gbrod103.seq - Rodent sequence entries, part 103. 4082. gbrod104.seq - Rodent sequence entries, part 104. 4083. gbrod105.seq - Rodent sequence entries, part 105. 4084. gbrod106.seq - Rodent sequence entries, part 106. 4085. gbrod107.seq - Rodent sequence entries, part 107. 4086. gbrod108.seq - Rodent sequence entries, part 108. 4087. gbrod109.seq - Rodent sequence entries, part 109. 4088. gbrod11.seq - Rodent sequence entries, part 11. 4089. gbrod110.seq - Rodent sequence entries, part 110. 4090. gbrod111.seq - Rodent sequence entries, part 111. 4091. gbrod112.seq - Rodent sequence entries, part 112. 4092. gbrod113.seq - Rodent sequence entries, part 113. 4093. gbrod114.seq - Rodent sequence entries, part 114. 4094. gbrod115.seq - Rodent sequence entries, part 115. 4095. gbrod116.seq - Rodent sequence entries, part 116. 4096. gbrod117.seq - Rodent sequence entries, part 117. 4097. gbrod118.seq - Rodent sequence entries, part 118. 4098. gbrod119.seq - Rodent sequence entries, part 119. 4099. gbrod12.seq - Rodent sequence entries, part 12. 4100. gbrod120.seq - Rodent sequence entries, part 120. 4101. gbrod13.seq - Rodent sequence entries, part 13. 4102. gbrod14.seq - Rodent sequence entries, part 14. 4103. gbrod15.seq - Rodent sequence entries, part 15. 4104. gbrod16.seq - Rodent sequence entries, part 16. 4105. gbrod17.seq - Rodent sequence entries, part 17. 4106. gbrod18.seq - Rodent sequence entries, part 18. 4107. gbrod19.seq - Rodent sequence entries, part 19. 4108. gbrod2.seq - Rodent sequence entries, part 2. 4109. gbrod20.seq - Rodent sequence entries, part 20. 4110. gbrod21.seq - Rodent sequence entries, part 21. 4111. gbrod22.seq - Rodent sequence entries, part 22. 4112. gbrod23.seq - Rodent sequence entries, part 23. 4113. gbrod24.seq - Rodent sequence entries, part 24. 4114. gbrod25.seq - Rodent sequence entries, part 25. 4115. gbrod26.seq - Rodent sequence entries, part 26. 4116. gbrod27.seq - Rodent sequence entries, part 27. 4117. gbrod28.seq - Rodent sequence entries, part 28. 4118. gbrod29.seq - Rodent sequence entries, part 29. 4119. gbrod3.seq - Rodent sequence entries, part 3. 4120. gbrod30.seq - Rodent sequence entries, part 30. 4121. gbrod31.seq - Rodent sequence entries, part 31. 4122. gbrod32.seq - Rodent sequence entries, part 32. 4123. gbrod33.seq - Rodent sequence entries, part 33. 4124. gbrod34.seq - Rodent sequence entries, part 34. 4125. gbrod35.seq - Rodent sequence entries, part 35. 4126. gbrod36.seq - Rodent sequence entries, part 36. 4127. gbrod37.seq - Rodent sequence entries, part 37. 4128. gbrod38.seq - Rodent sequence entries, part 38. 4129. gbrod39.seq - Rodent sequence entries, part 39. 4130. gbrod4.seq - Rodent sequence entries, part 4. 4131. gbrod40.seq - Rodent sequence entries, part 40. 4132. gbrod41.seq - Rodent sequence entries, part 41. 4133. gbrod42.seq - Rodent sequence entries, part 42. 4134. gbrod43.seq - Rodent sequence entries, part 43. 4135. gbrod44.seq - Rodent sequence entries, part 44. 4136. gbrod45.seq - Rodent sequence entries, part 45. 4137. gbrod46.seq - Rodent sequence entries, part 46. 4138. gbrod47.seq - Rodent sequence entries, part 47. 4139. gbrod48.seq - Rodent sequence entries, part 48. 4140. gbrod49.seq - Rodent sequence entries, part 49. 4141. gbrod5.seq - Rodent sequence entries, part 5. 4142. gbrod50.seq - Rodent sequence entries, part 50. 4143. gbrod51.seq - Rodent sequence entries, part 51. 4144. gbrod52.seq - Rodent sequence entries, part 52. 4145. gbrod53.seq - Rodent sequence entries, part 53. 4146. gbrod54.seq - Rodent sequence entries, part 54. 4147. gbrod55.seq - Rodent sequence entries, part 55. 4148. gbrod56.seq - Rodent sequence entries, part 56. 4149. gbrod57.seq - Rodent sequence entries, part 57. 4150. gbrod58.seq - Rodent sequence entries, part 58. 4151. gbrod59.seq - Rodent sequence entries, part 59. 4152. gbrod6.seq - Rodent sequence entries, part 6. 4153. gbrod60.seq - Rodent sequence entries, part 60. 4154. gbrod61.seq - Rodent sequence entries, part 61. 4155. gbrod62.seq - Rodent sequence entries, part 62. 4156. gbrod63.seq - Rodent sequence entries, part 63. 4157. gbrod64.seq - Rodent sequence entries, part 64. 4158. gbrod65.seq - Rodent sequence entries, part 65. 4159. gbrod66.seq - Rodent sequence entries, part 66. 4160. gbrod67.seq - Rodent sequence entries, part 67. 4161. gbrod68.seq - Rodent sequence entries, part 68. 4162. gbrod69.seq - Rodent sequence entries, part 69. 4163. gbrod7.seq - Rodent sequence entries, part 7. 4164. gbrod70.seq - Rodent sequence entries, part 70. 4165. gbrod71.seq - Rodent sequence entries, part 71. 4166. gbrod72.seq - Rodent sequence entries, part 72. 4167. gbrod73.seq - Rodent sequence entries, part 73. 4168. gbrod74.seq - Rodent sequence entries, part 74. 4169. gbrod75.seq - Rodent sequence entries, part 75. 4170. gbrod76.seq - Rodent sequence entries, part 76. 4171. gbrod77.seq - Rodent sequence entries, part 77. 4172. gbrod78.seq - Rodent sequence entries, part 78. 4173. gbrod79.seq - Rodent sequence entries, part 79. 4174. gbrod8.seq - Rodent sequence entries, part 8. 4175. gbrod80.seq - Rodent sequence entries, part 80. 4176. gbrod81.seq - Rodent sequence entries, part 81. 4177. gbrod82.seq - Rodent sequence entries, part 82. 4178. gbrod83.seq - Rodent sequence entries, part 83. 4179. gbrod84.seq - Rodent sequence entries, part 84. 4180. gbrod85.seq - Rodent sequence entries, part 85. 4181. gbrod86.seq - Rodent sequence entries, part 86. 4182. gbrod87.seq - Rodent sequence entries, part 87. 4183. gbrod88.seq - Rodent sequence entries, part 88. 4184. gbrod89.seq - Rodent sequence entries, part 89. 4185. gbrod9.seq - Rodent sequence entries, part 9. 4186. gbrod90.seq - Rodent sequence entries, part 90. 4187. gbrod91.seq - Rodent sequence entries, part 91. 4188. gbrod92.seq - Rodent sequence entries, part 92. 4189. gbrod93.seq - Rodent sequence entries, part 93. 4190. gbrod94.seq - Rodent sequence entries, part 94. 4191. gbrod95.seq - Rodent sequence entries, part 95. 4192. gbrod96.seq - Rodent sequence entries, part 96. 4193. gbrod97.seq - Rodent sequence entries, part 97. 4194. gbrod98.seq - Rodent sequence entries, part 98. 4195. gbrod99.seq - Rodent sequence entries, part 99. 4196. gbsts1.seq - STS (sequence tagged site) sequence entries, part 1. 4197. gbsts2.seq - STS (sequence tagged site) sequence entries, part 2. 4198. gbsts3.seq - STS (sequence tagged site) sequence entries, part 3. 4199. gbsts4.seq - STS (sequence tagged site) sequence entries, part 4. 4200. gbsyn1.seq - Synthetic and chimeric sequence entries, part 1. 4201. gbsyn10.seq - Synthetic and chimeric sequence entries, part 10. 4202. gbsyn11.seq - Synthetic and chimeric sequence entries, part 11. 4203. gbsyn2.seq - Synthetic and chimeric sequence entries, part 2. 4204. gbsyn3.seq - Synthetic and chimeric sequence entries, part 3. 4205. gbsyn4.seq - Synthetic and chimeric sequence entries, part 4. 4206. gbsyn5.seq - Synthetic and chimeric sequence entries, part 5. 4207. gbsyn6.seq - Synthetic and chimeric sequence entries, part 6. 4208. gbsyn7.seq - Synthetic and chimeric sequence entries, part 7. 4209. gbsyn8.seq - Synthetic and chimeric sequence entries, part 8. 4210. gbsyn9.seq - Synthetic and chimeric sequence entries, part 9. 4211. gbtsa1.seq - TSA (transcriptome shotgun assembly) sequence entries, part 1. 4212. gbtsa10.seq - TSA (transcriptome shotgun assembly) sequence entries, part 10. 4213. gbtsa11.seq - TSA (transcriptome shotgun assembly) sequence entries, part 11. 4214. gbtsa12.seq - TSA (transcriptome shotgun assembly) sequence entries, part 12. 4215. gbtsa13.seq - TSA (transcriptome shotgun assembly) sequence entries, part 13. 4216. gbtsa14.seq - TSA (transcriptome shotgun assembly) sequence entries, part 14. 4217. gbtsa15.seq - TSA (transcriptome shotgun assembly) sequence entries, part 15. 4218. gbtsa16.seq - TSA (transcriptome shotgun assembly) sequence entries, part 16. 4219. gbtsa17.seq - TSA (transcriptome shotgun assembly) sequence entries, part 17. 4220. gbtsa18.seq - TSA (transcriptome shotgun assembly) sequence entries, part 18. 4221. gbtsa19.seq - TSA (transcriptome shotgun assembly) sequence entries, part 19. 4222. gbtsa2.seq - TSA (transcriptome shotgun assembly) sequence entries, part 2. 4223. gbtsa20.seq - TSA (transcriptome shotgun assembly) sequence entries, part 20. 4224. gbtsa21.seq - TSA (transcriptome shotgun assembly) sequence entries, part 21. 4225. gbtsa22.seq - TSA (transcriptome shotgun assembly) sequence entries, part 22. 4226. gbtsa23.seq - TSA (transcriptome shotgun assembly) sequence entries, part 23. 4227. gbtsa24.seq - TSA (transcriptome shotgun assembly) sequence entries, part 24. 4228. gbtsa25.seq - TSA (transcriptome shotgun assembly) sequence entries, part 25. 4229. gbtsa26.seq - TSA (transcriptome shotgun assembly) sequence entries, part 26. 4230. gbtsa27.seq - TSA (transcriptome shotgun assembly) sequence entries, part 27. 4231. gbtsa28.seq - TSA (transcriptome shotgun assembly) sequence entries, part 28. 4232. gbtsa29.seq - TSA (transcriptome shotgun assembly) sequence entries, part 29. 4233. gbtsa3.seq - TSA (transcriptome shotgun assembly) sequence entries, part 3. 4234. gbtsa30.seq - TSA (transcriptome shotgun assembly) sequence entries, part 30. 4235. gbtsa31.seq - TSA (transcriptome shotgun assembly) sequence entries, part 31. 4236. gbtsa32.seq - TSA (transcriptome shotgun assembly) sequence entries, part 32. 4237. gbtsa33.seq - TSA (transcriptome shotgun assembly) sequence entries, part 33. 4238. gbtsa34.seq - TSA (transcriptome shotgun assembly) sequence entries, part 34. 4239. gbtsa35.seq - TSA (transcriptome shotgun assembly) sequence entries, part 35. 4240. gbtsa36.seq - TSA (transcriptome shotgun assembly) sequence entries, part 36. 4241. gbtsa37.seq - TSA (transcriptome shotgun assembly) sequence entries, part 37. 4242. gbtsa38.seq - TSA (transcriptome shotgun assembly) sequence entries, part 38. 4243. gbtsa39.seq - TSA (transcriptome shotgun assembly) sequence entries, part 39. 4244. gbtsa4.seq - TSA (transcriptome shotgun assembly) sequence entries, part 4. 4245. gbtsa40.seq - TSA (transcriptome shotgun assembly) sequence entries, part 40. 4246. gbtsa41.seq - TSA (transcriptome shotgun assembly) sequence entries, part 41. 4247. gbtsa42.seq - TSA (transcriptome shotgun assembly) sequence entries, part 42. 4248. gbtsa43.seq - TSA (transcriptome shotgun assembly) sequence entries, part 43. 4249. gbtsa44.seq - TSA (transcriptome shotgun assembly) sequence entries, part 44. 4250. gbtsa45.seq - TSA (transcriptome shotgun assembly) sequence entries, part 45. 4251. gbtsa46.seq - TSA (transcriptome shotgun assembly) sequence entries, part 46. 4252. gbtsa47.seq - TSA (transcriptome shotgun assembly) sequence entries, part 47. 4253. gbtsa48.seq - TSA (transcriptome shotgun assembly) sequence entries, part 48. 4254. gbtsa49.seq - TSA (transcriptome shotgun assembly) sequence entries, part 49. 4255. gbtsa5.seq - TSA (transcriptome shotgun assembly) sequence entries, part 5. 4256. gbtsa50.seq - TSA (transcriptome shotgun assembly) sequence entries, part 50. 4257. gbtsa51.seq - TSA (transcriptome shotgun assembly) sequence entries, part 51. 4258. gbtsa52.seq - TSA (transcriptome shotgun assembly) sequence entries, part 52. 4259. gbtsa53.seq - TSA (transcriptome shotgun assembly) sequence entries, part 53. 4260. gbtsa54.seq - TSA (transcriptome shotgun assembly) sequence entries, part 54. 4261. gbtsa55.seq - TSA (transcriptome shotgun assembly) sequence entries, part 55. 4262. gbtsa6.seq - TSA (transcriptome shotgun assembly) sequence entries, part 6. 4263. gbtsa7.seq - TSA (transcriptome shotgun assembly) sequence entries, part 7. 4264. gbtsa8.seq - TSA (transcriptome shotgun assembly) sequence entries, part 8. 4265. gbtsa9.seq - TSA (transcriptome shotgun assembly) sequence entries, part 9. 4266. gbuna1.seq - Unannotated sequence entries, part 1. 4267. gbvrl1.seq - Viral sequence entries, part 1. 4268. gbvrl10.seq - Viral sequence entries, part 10. 4269. gbvrl100.seq - Viral sequence entries, part 100. 4270. gbvrl101.seq - Viral sequence entries, part 101. 4271. gbvrl102.seq - Viral sequence entries, part 102. 4272. gbvrl103.seq - Viral sequence entries, part 103. 4273. gbvrl104.seq - Viral sequence entries, part 104. 4274. gbvrl105.seq - Viral sequence entries, part 105. 4275. gbvrl106.seq - Viral sequence entries, part 106. 4276. gbvrl107.seq - Viral sequence entries, part 107. 4277. gbvrl108.seq - Viral sequence entries, part 108. 4278. gbvrl109.seq - Viral sequence entries, part 109. 4279. gbvrl11.seq - Viral sequence entries, part 11. 4280. gbvrl110.seq - Viral sequence entries, part 110. 4281. gbvrl111.seq - Viral sequence entries, part 111. 4282. gbvrl112.seq - Viral sequence entries, part 112. 4283. gbvrl113.seq - Viral sequence entries, part 113. 4284. gbvrl114.seq - Viral sequence entries, part 114. 4285. gbvrl115.seq - Viral sequence entries, part 115. 4286. gbvrl116.seq - Viral sequence entries, part 116. 4287. gbvrl117.seq - Viral sequence entries, part 117. 4288. gbvrl118.seq - Viral sequence entries, part 118. 4289. gbvrl119.seq - Viral sequence entries, part 119. 4290. gbvrl12.seq - Viral sequence entries, part 12. 4291. gbvrl120.seq - Viral sequence entries, part 120. 4292. gbvrl121.seq - Viral sequence entries, part 121. 4293. gbvrl122.seq - Viral sequence entries, part 122. 4294. gbvrl123.seq - Viral sequence entries, part 123. 4295. gbvrl124.seq - Viral sequence entries, part 124. 4296. gbvrl125.seq - Viral sequence entries, part 125. 4297. gbvrl126.seq - Viral sequence entries, part 126. 4298. gbvrl127.seq - Viral sequence entries, part 127. 4299. gbvrl128.seq - Viral sequence entries, part 128. 4300. gbvrl129.seq - Viral sequence entries, part 129. 4301. gbvrl13.seq - Viral sequence entries, part 13. 4302. gbvrl130.seq - Viral sequence entries, part 130. 4303. gbvrl131.seq - Viral sequence entries, part 131. 4304. gbvrl132.seq - Viral sequence entries, part 132. 4305. gbvrl133.seq - Viral sequence entries, part 133. 4306. gbvrl134.seq - Viral sequence entries, part 134. 4307. gbvrl135.seq - Viral sequence entries, part 135. 4308. gbvrl136.seq - Viral sequence entries, part 136. 4309. gbvrl137.seq - Viral sequence entries, part 137. 4310. gbvrl138.seq - Viral sequence entries, part 138. 4311. gbvrl139.seq - Viral sequence entries, part 139. 4312. gbvrl14.seq - Viral sequence entries, part 14. 4313. gbvrl140.seq - Viral sequence entries, part 140. 4314. gbvrl141.seq - Viral sequence entries, part 141. 4315. gbvrl142.seq - Viral sequence entries, part 142. 4316. gbvrl143.seq - Viral sequence entries, part 143. 4317. gbvrl144.seq - Viral sequence entries, part 144. 4318. gbvrl145.seq - Viral sequence entries, part 145. 4319. gbvrl146.seq - Viral sequence entries, part 146. 4320. gbvrl147.seq - Viral sequence entries, part 147. 4321. gbvrl148.seq - Viral sequence entries, part 148. 4322. gbvrl149.seq - Viral sequence entries, part 149. 4323. gbvrl15.seq - Viral sequence entries, part 15. 4324. gbvrl150.seq - Viral sequence entries, part 150. 4325. gbvrl151.seq - Viral sequence entries, part 151. 4326. gbvrl152.seq - Viral sequence entries, part 152. 4327. gbvrl153.seq - Viral sequence entries, part 153. 4328. gbvrl154.seq - Viral sequence entries, part 154. 4329. gbvrl155.seq - Viral sequence entries, part 155. 4330. gbvrl156.seq - Viral sequence entries, part 156. 4331. gbvrl157.seq - Viral sequence entries, part 157. 4332. gbvrl158.seq - Viral sequence entries, part 158. 4333. gbvrl159.seq - Viral sequence entries, part 159. 4334. gbvrl16.seq - Viral sequence entries, part 16. 4335. gbvrl160.seq - Viral sequence entries, part 160. 4336. gbvrl161.seq - Viral sequence entries, part 161. 4337. gbvrl162.seq - Viral sequence entries, part 162. 4338. gbvrl163.seq - Viral sequence entries, part 163. 4339. gbvrl164.seq - Viral sequence entries, part 164. 4340. gbvrl165.seq - Viral sequence entries, part 165. 4341. gbvrl166.seq - Viral sequence entries, part 166. 4342. gbvrl167.seq - Viral sequence entries, part 167. 4343. gbvrl168.seq - Viral sequence entries, part 168. 4344. gbvrl169.seq - Viral sequence entries, part 169. 4345. gbvrl17.seq - Viral sequence entries, part 17. 4346. gbvrl170.seq - Viral sequence entries, part 170. 4347. gbvrl171.seq - Viral sequence entries, part 171. 4348. gbvrl172.seq - Viral sequence entries, part 172. 4349. gbvrl173.seq - Viral sequence entries, part 173. 4350. gbvrl174.seq - Viral sequence entries, part 174. 4351. gbvrl175.seq - Viral sequence entries, part 175. 4352. gbvrl176.seq - Viral sequence entries, part 176. 4353. gbvrl177.seq - Viral sequence entries, part 177. 4354. gbvrl178.seq - Viral sequence entries, part 178. 4355. gbvrl179.seq - Viral sequence entries, part 179. 4356. gbvrl18.seq - Viral sequence entries, part 18. 4357. gbvrl180.seq - Viral sequence entries, part 180. 4358. gbvrl181.seq - Viral sequence entries, part 181. 4359. gbvrl182.seq - Viral sequence entries, part 182. 4360. gbvrl183.seq - Viral sequence entries, part 183. 4361. gbvrl184.seq - Viral sequence entries, part 184. 4362. gbvrl185.seq - Viral sequence entries, part 185. 4363. gbvrl186.seq - Viral sequence entries, part 186. 4364. gbvrl187.seq - Viral sequence entries, part 187. 4365. gbvrl188.seq - Viral sequence entries, part 188. 4366. gbvrl189.seq - Viral sequence entries, part 189. 4367. gbvrl19.seq - Viral sequence entries, part 19. 4368. gbvrl190.seq - Viral sequence entries, part 190. 4369. gbvrl191.seq - Viral sequence entries, part 191. 4370. gbvrl192.seq - Viral sequence entries, part 192. 4371. gbvrl193.seq - Viral sequence entries, part 193. 4372. gbvrl194.seq - Viral sequence entries, part 194. 4373. gbvrl195.seq - Viral sequence entries, part 195. 4374. gbvrl196.seq - Viral sequence entries, part 196. 4375. gbvrl197.seq - Viral sequence entries, part 197. 4376. gbvrl198.seq - Viral sequence entries, part 198. 4377. gbvrl199.seq - Viral sequence entries, part 199. 4378. gbvrl2.seq - Viral sequence entries, part 2. 4379. gbvrl20.seq - Viral sequence entries, part 20. 4380. gbvrl200.seq - Viral sequence entries, part 200. 4381. gbvrl201.seq - Viral sequence entries, part 201. 4382. gbvrl202.seq - Viral sequence entries, part 202. 4383. gbvrl203.seq - Viral sequence entries, part 203. 4384. gbvrl204.seq - Viral sequence entries, part 204. 4385. gbvrl205.seq - Viral sequence entries, part 205. 4386. gbvrl206.seq - Viral sequence entries, part 206. 4387. gbvrl207.seq - Viral sequence entries, part 207. 4388. gbvrl208.seq - Viral sequence entries, part 208. 4389. gbvrl209.seq - Viral sequence entries, part 209. 4390. gbvrl21.seq - Viral sequence entries, part 21. 4391. gbvrl210.seq - Viral sequence entries, part 210. 4392. gbvrl211.seq - Viral sequence entries, part 211. 4393. gbvrl212.seq - Viral sequence entries, part 212. 4394. gbvrl213.seq - Viral sequence entries, part 213. 4395. gbvrl214.seq - Viral sequence entries, part 214. 4396. gbvrl215.seq - Viral sequence entries, part 215. 4397. gbvrl216.seq - Viral sequence entries, part 216. 4398. gbvrl217.seq - Viral sequence entries, part 217. 4399. gbvrl218.seq - Viral sequence entries, part 218. 4400. gbvrl219.seq - Viral sequence entries, part 219. 4401. gbvrl22.seq - Viral sequence entries, part 22. 4402. gbvrl220.seq - Viral sequence entries, part 220. 4403. gbvrl221.seq - Viral sequence entries, part 221. 4404. gbvrl222.seq - Viral sequence entries, part 222. 4405. gbvrl223.seq - Viral sequence entries, part 223. 4406. gbvrl224.seq - Viral sequence entries, part 224. 4407. gbvrl225.seq - Viral sequence entries, part 225. 4408. gbvrl226.seq - Viral sequence entries, part 226. 4409. gbvrl227.seq - Viral sequence entries, part 227. 4410. gbvrl228.seq - Viral sequence entries, part 228. 4411. gbvrl229.seq - Viral sequence entries, part 229. 4412. gbvrl23.seq - Viral sequence entries, part 23. 4413. gbvrl230.seq - Viral sequence entries, part 230. 4414. gbvrl231.seq - Viral sequence entries, part 231. 4415. gbvrl232.seq - Viral sequence entries, part 232. 4416. gbvrl233.seq - Viral sequence entries, part 233. 4417. gbvrl234.seq - Viral sequence entries, part 234. 4418. gbvrl235.seq - Viral sequence entries, part 235. 4419. gbvrl236.seq - Viral sequence entries, part 236. 4420. gbvrl237.seq - Viral sequence entries, part 237. 4421. gbvrl238.seq - Viral sequence entries, part 238. 4422. gbvrl239.seq - Viral sequence entries, part 239. 4423. gbvrl24.seq - Viral sequence entries, part 24. 4424. gbvrl240.seq - Viral sequence entries, part 240. 4425. gbvrl241.seq - Viral sequence entries, part 241. 4426. gbvrl242.seq - Viral sequence entries, part 242. 4427. gbvrl243.seq - Viral sequence entries, part 243. 4428. gbvrl244.seq - Viral sequence entries, part 244. 4429. gbvrl245.seq - Viral sequence entries, part 245. 4430. gbvrl246.seq - Viral sequence entries, part 246. 4431. gbvrl247.seq - Viral sequence entries, part 247. 4432. gbvrl248.seq - Viral sequence entries, part 248. 4433. gbvrl249.seq - Viral sequence entries, part 249. 4434. gbvrl25.seq - Viral sequence entries, part 25. 4435. gbvrl250.seq - Viral sequence entries, part 250. 4436. gbvrl251.seq - Viral sequence entries, part 251. 4437. gbvrl252.seq - Viral sequence entries, part 252. 4438. gbvrl253.seq - Viral sequence entries, part 253. 4439. gbvrl254.seq - Viral sequence entries, part 254. 4440. gbvrl255.seq - Viral sequence entries, part 255. 4441. gbvrl256.seq - Viral sequence entries, part 256. 4442. gbvrl257.seq - Viral sequence entries, part 257. 4443. gbvrl258.seq - Viral sequence entries, part 258. 4444. gbvrl259.seq - Viral sequence entries, part 259. 4445. gbvrl26.seq - Viral sequence entries, part 26. 4446. gbvrl260.seq - Viral sequence entries, part 260. 4447. gbvrl261.seq - Viral sequence entries, part 261. 4448. gbvrl262.seq - Viral sequence entries, part 262. 4449. gbvrl263.seq - Viral sequence entries, part 263. 4450. gbvrl264.seq - Viral sequence entries, part 264. 4451. gbvrl265.seq - Viral sequence entries, part 265. 4452. gbvrl266.seq - Viral sequence entries, part 266. 4453. gbvrl267.seq - Viral sequence entries, part 267. 4454. gbvrl268.seq - Viral sequence entries, part 268. 4455. gbvrl269.seq - Viral sequence entries, part 269. 4456. gbvrl27.seq - Viral sequence entries, part 27. 4457. gbvrl270.seq - Viral sequence entries, part 270. 4458. gbvrl271.seq - Viral sequence entries, part 271. 4459. gbvrl272.seq - Viral sequence entries, part 272. 4460. gbvrl273.seq - Viral sequence entries, part 273. 4461. gbvrl274.seq - Viral sequence entries, part 274. 4462. gbvrl275.seq - Viral sequence entries, part 275. 4463. gbvrl276.seq - Viral sequence entries, part 276. 4464. gbvrl277.seq - Viral sequence entries, part 277. 4465. gbvrl278.seq - Viral sequence entries, part 278. 4466. gbvrl279.seq - Viral sequence entries, part 279. 4467. gbvrl28.seq - Viral sequence entries, part 28. 4468. gbvrl280.seq - Viral sequence entries, part 280. 4469. gbvrl281.seq - Viral sequence entries, part 281. 4470. gbvrl282.seq - Viral sequence entries, part 282. 4471. gbvrl283.seq - Viral sequence entries, part 283. 4472. gbvrl284.seq - Viral sequence entries, part 284. 4473. gbvrl285.seq - Viral sequence entries, part 285. 4474. gbvrl286.seq - Viral sequence entries, part 286. 4475. gbvrl287.seq - Viral sequence entries, part 287. 4476. gbvrl288.seq - Viral sequence entries, part 288. 4477. gbvrl289.seq - Viral sequence entries, part 289. 4478. gbvrl29.seq - Viral sequence entries, part 29. 4479. gbvrl290.seq - Viral sequence entries, part 290. 4480. gbvrl291.seq - Viral sequence entries, part 291. 4481. gbvrl292.seq - Viral sequence entries, part 292. 4482. gbvrl293.seq - Viral sequence entries, part 293. 4483. gbvrl294.seq - Viral sequence entries, part 294. 4484. gbvrl295.seq - Viral sequence entries, part 295. 4485. gbvrl296.seq - Viral sequence entries, part 296. 4486. gbvrl297.seq - Viral sequence entries, part 297. 4487. gbvrl298.seq - Viral sequence entries, part 298. 4488. gbvrl299.seq - Viral sequence entries, part 299. 4489. gbvrl3.seq - Viral sequence entries, part 3. 4490. gbvrl30.seq - Viral sequence entries, part 30. 4491. gbvrl300.seq - Viral sequence entries, part 300. 4492. gbvrl301.seq - Viral sequence entries, part 301. 4493. gbvrl302.seq - Viral sequence entries, part 302. 4494. gbvrl303.seq - Viral sequence entries, part 303. 4495. gbvrl304.seq - Viral sequence entries, part 304. 4496. gbvrl305.seq - Viral sequence entries, part 305. 4497. gbvrl306.seq - Viral sequence entries, part 306. 4498. gbvrl307.seq - Viral sequence entries, part 307. 4499. gbvrl308.seq - Viral sequence entries, part 308. 4500. gbvrl309.seq - Viral sequence entries, part 309. 4501. gbvrl31.seq - Viral sequence entries, part 31. 4502. gbvrl310.seq - Viral sequence entries, part 310. 4503. gbvrl311.seq - Viral sequence entries, part 311. 4504. gbvrl312.seq - Viral sequence entries, part 312. 4505. gbvrl313.seq - Viral sequence entries, part 313. 4506. gbvrl314.seq - Viral sequence entries, part 314. 4507. gbvrl315.seq - Viral sequence entries, part 315. 4508. gbvrl316.seq - Viral sequence entries, part 316. 4509. gbvrl317.seq - Viral sequence entries, part 317. 4510. gbvrl318.seq - Viral sequence entries, part 318. 4511. gbvrl319.seq - Viral sequence entries, part 319. 4512. gbvrl32.seq - Viral sequence entries, part 32. 4513. gbvrl320.seq - Viral sequence entries, part 320. 4514. gbvrl321.seq - Viral sequence entries, part 321. 4515. gbvrl322.seq - Viral sequence entries, part 322. 4516. gbvrl323.seq - Viral sequence entries, part 323. 4517. gbvrl324.seq - Viral sequence entries, part 324. 4518. gbvrl325.seq - Viral sequence entries, part 325. 4519. gbvrl326.seq - Viral sequence entries, part 326. 4520. gbvrl327.seq - Viral sequence entries, part 327. 4521. gbvrl328.seq - Viral sequence entries, part 328. 4522. gbvrl329.seq - Viral sequence entries, part 329. 4523. gbvrl33.seq - Viral sequence entries, part 33. 4524. gbvrl330.seq - Viral sequence entries, part 330. 4525. gbvrl331.seq - Viral sequence entries, part 331. 4526. gbvrl332.seq - Viral sequence entries, part 332. 4527. gbvrl333.seq - Viral sequence entries, part 333. 4528. gbvrl334.seq - Viral sequence entries, part 334. 4529. gbvrl335.seq - Viral sequence entries, part 335. 4530. gbvrl336.seq - Viral sequence entries, part 336. 4531. gbvrl337.seq - Viral sequence entries, part 337. 4532. gbvrl338.seq - Viral sequence entries, part 338. 4533. gbvrl339.seq - Viral sequence entries, part 339. 4534. gbvrl34.seq - Viral sequence entries, part 34. 4535. gbvrl340.seq - Viral sequence entries, part 340. 4536. gbvrl341.seq - Viral sequence entries, part 341. 4537. gbvrl342.seq - Viral sequence entries, part 342. 4538. gbvrl343.seq - Viral sequence entries, part 343. 4539. gbvrl344.seq - Viral sequence entries, part 344. 4540. gbvrl345.seq - Viral sequence entries, part 345. 4541. gbvrl346.seq - Viral sequence entries, part 346. 4542. gbvrl347.seq - Viral sequence entries, part 347. 4543. gbvrl348.seq - Viral sequence entries, part 348. 4544. gbvrl349.seq - Viral sequence entries, part 349. 4545. gbvrl35.seq - Viral sequence entries, part 35. 4546. gbvrl350.seq - Viral sequence entries, part 350. 4547. gbvrl351.seq - Viral sequence entries, part 351. 4548. gbvrl352.seq - Viral sequence entries, part 352. 4549. gbvrl353.seq - Viral sequence entries, part 353. 4550. gbvrl354.seq - Viral sequence entries, part 354. 4551. gbvrl355.seq - Viral sequence entries, part 355. 4552. gbvrl356.seq - Viral sequence entries, part 356. 4553. gbvrl357.seq - Viral sequence entries, part 357. 4554. gbvrl358.seq - Viral sequence entries, part 358. 4555. gbvrl359.seq - Viral sequence entries, part 359. 4556. gbvrl36.seq - Viral sequence entries, part 36. 4557. gbvrl360.seq - Viral sequence entries, part 360. 4558. gbvrl361.seq - Viral sequence entries, part 361. 4559. gbvrl362.seq - Viral sequence entries, part 362. 4560. gbvrl363.seq - Viral sequence entries, part 363. 4561. gbvrl364.seq - Viral sequence entries, part 364. 4562. gbvrl365.seq - Viral sequence entries, part 365. 4563. gbvrl366.seq - Viral sequence entries, part 366. 4564. gbvrl367.seq - Viral sequence entries, part 367. 4565. gbvrl368.seq - Viral sequence entries, part 368. 4566. gbvrl369.seq - Viral sequence entries, part 369. 4567. gbvrl37.seq - Viral sequence entries, part 37. 4568. gbvrl370.seq - Viral sequence entries, part 370. 4569. gbvrl371.seq - Viral sequence entries, part 371. 4570. gbvrl372.seq - Viral sequence entries, part 372. 4571. gbvrl373.seq - Viral sequence entries, part 373. 4572. gbvrl374.seq - Viral sequence entries, part 374. 4573. gbvrl375.seq - Viral sequence entries, part 375. 4574. gbvrl376.seq - Viral sequence entries, part 376. 4575. gbvrl377.seq - Viral sequence entries, part 377. 4576. gbvrl378.seq - Viral sequence entries, part 378. 4577. gbvrl379.seq - Viral sequence entries, part 379. 4578. gbvrl38.seq - Viral sequence entries, part 38. 4579. gbvrl380.seq - Viral sequence entries, part 380. 4580. gbvrl381.seq - Viral sequence entries, part 381. 4581. gbvrl382.seq - Viral sequence entries, part 382. 4582. gbvrl383.seq - Viral sequence entries, part 383. 4583. gbvrl384.seq - Viral sequence entries, part 384. 4584. gbvrl385.seq - Viral sequence entries, part 385. 4585. gbvrl386.seq - Viral sequence entries, part 386. 4586. gbvrl387.seq - Viral sequence entries, part 387. 4587. gbvrl388.seq - Viral sequence entries, part 388. 4588. gbvrl389.seq - Viral sequence entries, part 389. 4589. gbvrl39.seq - Viral sequence entries, part 39. 4590. gbvrl390.seq - Viral sequence entries, part 390. 4591. gbvrl391.seq - Viral sequence entries, part 391. 4592. gbvrl392.seq - Viral sequence entries, part 392. 4593. gbvrl393.seq - Viral sequence entries, part 393. 4594. gbvrl394.seq - Viral sequence entries, part 394. 4595. gbvrl395.seq - Viral sequence entries, part 395. 4596. gbvrl396.seq - Viral sequence entries, part 396. 4597. gbvrl397.seq - Viral sequence entries, part 397. 4598. gbvrl398.seq - Viral sequence entries, part 398. 4599. gbvrl399.seq - Viral sequence entries, part 399. 4600. gbvrl4.seq - Viral sequence entries, part 4. 4601. gbvrl40.seq - Viral sequence entries, part 40. 4602. gbvrl400.seq - Viral sequence entries, part 400. 4603. gbvrl401.seq - Viral sequence entries, part 401. 4604. gbvrl402.seq - Viral sequence entries, part 402. 4605. gbvrl403.seq - Viral sequence entries, part 403. 4606. gbvrl404.seq - Viral sequence entries, part 404. 4607. gbvrl405.seq - Viral sequence entries, part 405. 4608. gbvrl406.seq - Viral sequence entries, part 406. 4609. gbvrl407.seq - Viral sequence entries, part 407. 4610. gbvrl408.seq - Viral sequence entries, part 408. 4611. gbvrl409.seq - Viral sequence entries, part 409. 4612. gbvrl41.seq - Viral sequence entries, part 41. 4613. gbvrl410.seq - Viral sequence entries, part 410. 4614. gbvrl411.seq - Viral sequence entries, part 411. 4615. gbvrl412.seq - Viral sequence entries, part 412. 4616. gbvrl413.seq - Viral sequence entries, part 413. 4617. gbvrl414.seq - Viral sequence entries, part 414. 4618. gbvrl415.seq - Viral sequence entries, part 415. 4619. gbvrl416.seq - Viral sequence entries, part 416. 4620. gbvrl417.seq - Viral sequence entries, part 417. 4621. gbvrl418.seq - Viral sequence entries, part 418. 4622. gbvrl419.seq - Viral sequence entries, part 419. 4623. gbvrl42.seq - Viral sequence entries, part 42. 4624. gbvrl420.seq - Viral sequence entries, part 420. 4625. gbvrl421.seq - Viral sequence entries, part 421. 4626. gbvrl422.seq - Viral sequence entries, part 422. 4627. gbvrl423.seq - Viral sequence entries, part 423. 4628. gbvrl424.seq - Viral sequence entries, part 424. 4629. gbvrl425.seq - Viral sequence entries, part 425. 4630. gbvrl426.seq - Viral sequence entries, part 426. 4631. gbvrl427.seq - Viral sequence entries, part 427. 4632. gbvrl428.seq - Viral sequence entries, part 428. 4633. gbvrl429.seq - Viral sequence entries, part 429. 4634. gbvrl43.seq - Viral sequence entries, part 43. 4635. gbvrl430.seq - Viral sequence entries, part 430. 4636. gbvrl431.seq - Viral sequence entries, part 431. 4637. gbvrl432.seq - Viral sequence entries, part 432. 4638. gbvrl433.seq - Viral sequence entries, part 433. 4639. gbvrl434.seq - Viral sequence entries, part 434. 4640. gbvrl435.seq - Viral sequence entries, part 435. 4641. gbvrl436.seq - Viral sequence entries, part 436. 4642. gbvrl437.seq - Viral sequence entries, part 437. 4643. gbvrl438.seq - Viral sequence entries, part 438. 4644. gbvrl439.seq - Viral sequence entries, part 439. 4645. gbvrl44.seq - Viral sequence entries, part 44. 4646. gbvrl440.seq - Viral sequence entries, part 440. 4647. gbvrl441.seq - Viral sequence entries, part 441. 4648. gbvrl442.seq - Viral sequence entries, part 442. 4649. gbvrl443.seq - Viral sequence entries, part 443. 4650. gbvrl444.seq - Viral sequence entries, part 444. 4651. gbvrl445.seq - Viral sequence entries, part 445. 4652. gbvrl446.seq - Viral sequence entries, part 446. 4653. gbvrl447.seq - Viral sequence entries, part 447. 4654. gbvrl448.seq - Viral sequence entries, part 448. 4655. gbvrl449.seq - Viral sequence entries, part 449. 4656. gbvrl45.seq - Viral sequence entries, part 45. 4657. gbvrl450.seq - Viral sequence entries, part 450. 4658. gbvrl451.seq - Viral sequence entries, part 451. 4659. gbvrl452.seq - Viral sequence entries, part 452. 4660. gbvrl453.seq - Viral sequence entries, part 453. 4661. gbvrl454.seq - Viral sequence entries, part 454. 4662. gbvrl455.seq - Viral sequence entries, part 455. 4663. gbvrl456.seq - Viral sequence entries, part 456. 4664. gbvrl457.seq - Viral sequence entries, part 457. 4665. gbvrl458.seq - Viral sequence entries, part 458. 4666. gbvrl459.seq - Viral sequence entries, part 459. 4667. gbvrl46.seq - Viral sequence entries, part 46. 4668. gbvrl460.seq - Viral sequence entries, part 460. 4669. gbvrl461.seq - Viral sequence entries, part 461. 4670. gbvrl462.seq - Viral sequence entries, part 462. 4671. gbvrl463.seq - Viral sequence entries, part 463. 4672. gbvrl464.seq - Viral sequence entries, part 464. 4673. gbvrl465.seq - Viral sequence entries, part 465. 4674. gbvrl466.seq - Viral sequence entries, part 466. 4675. gbvrl467.seq - Viral sequence entries, part 467. 4676. gbvrl468.seq - Viral sequence entries, part 468. 4677. gbvrl469.seq - Viral sequence entries, part 469. 4678. gbvrl47.seq - Viral sequence entries, part 47. 4679. gbvrl470.seq - Viral sequence entries, part 470. 4680. gbvrl471.seq - Viral sequence entries, part 471. 4681. gbvrl472.seq - Viral sequence entries, part 472. 4682. gbvrl473.seq - Viral sequence entries, part 473. 4683. gbvrl474.seq - Viral sequence entries, part 474. 4684. gbvrl475.seq - Viral sequence entries, part 475. 4685. gbvrl476.seq - Viral sequence entries, part 476. 4686. gbvrl477.seq - Viral sequence entries, part 477. 4687. gbvrl478.seq - Viral sequence entries, part 478. 4688. gbvrl479.seq - Viral sequence entries, part 479. 4689. gbvrl48.seq - Viral sequence entries, part 48. 4690. gbvrl480.seq - Viral sequence entries, part 480. 4691. gbvrl481.seq - Viral sequence entries, part 481. 4692. gbvrl482.seq - Viral sequence entries, part 482. 4693. gbvrl483.seq - Viral sequence entries, part 483. 4694. gbvrl484.seq - Viral sequence entries, part 484. 4695. gbvrl485.seq - Viral sequence entries, part 485. 4696. gbvrl486.seq - Viral sequence entries, part 486. 4697. gbvrl487.seq - Viral sequence entries, part 487. 4698. gbvrl488.seq - Viral sequence entries, part 488. 4699. gbvrl489.seq - Viral sequence entries, part 489. 4700. gbvrl49.seq - Viral sequence entries, part 49. 4701. gbvrl490.seq - Viral sequence entries, part 490. 4702. gbvrl491.seq - Viral sequence entries, part 491. 4703. gbvrl492.seq - Viral sequence entries, part 492. 4704. gbvrl493.seq - Viral sequence entries, part 493. 4705. gbvrl494.seq - Viral sequence entries, part 494. 4706. gbvrl495.seq - Viral sequence entries, part 495. 4707. gbvrl496.seq - Viral sequence entries, part 496. 4708. gbvrl497.seq - Viral sequence entries, part 497. 4709. gbvrl498.seq - Viral sequence entries, part 498. 4710. gbvrl499.seq - Viral sequence entries, part 499. 4711. gbvrl5.seq - Viral sequence entries, part 5. 4712. gbvrl50.seq - Viral sequence entries, part 50. 4713. gbvrl500.seq - Viral sequence entries, part 500. 4714. gbvrl51.seq - Viral sequence entries, part 51. 4715. gbvrl52.seq - Viral sequence entries, part 52. 4716. gbvrl53.seq - Viral sequence entries, part 53. 4717. gbvrl54.seq - Viral sequence entries, part 54. 4718. gbvrl55.seq - Viral sequence entries, part 55. 4719. gbvrl56.seq - Viral sequence entries, part 56. 4720. gbvrl57.seq - Viral sequence entries, part 57. 4721. gbvrl58.seq - Viral sequence entries, part 58. 4722. gbvrl59.seq - Viral sequence entries, part 59. 4723. gbvrl6.seq - Viral sequence entries, part 6. 4724. gbvrl60.seq - Viral sequence entries, part 60. 4725. gbvrl61.seq - Viral sequence entries, part 61. 4726. gbvrl62.seq - Viral sequence entries, part 62. 4727. gbvrl63.seq - Viral sequence entries, part 63. 4728. gbvrl64.seq - Viral sequence entries, part 64. 4729. gbvrl65.seq - Viral sequence entries, part 65. 4730. gbvrl66.seq - Viral sequence entries, part 66. 4731. gbvrl67.seq - Viral sequence entries, part 67. 4732. gbvrl68.seq - Viral sequence entries, part 68. 4733. gbvrl69.seq - Viral sequence entries, part 69. 4734. gbvrl7.seq - Viral sequence entries, part 7. 4735. gbvrl70.seq - Viral sequence entries, part 70. 4736. gbvrl71.seq - Viral sequence entries, part 71. 4737. gbvrl72.seq - Viral sequence entries, part 72. 4738. gbvrl73.seq - Viral sequence entries, part 73. 4739. gbvrl74.seq - Viral sequence entries, part 74. 4740. gbvrl75.seq - Viral sequence entries, part 75. 4741. gbvrl76.seq - Viral sequence entries, part 76. 4742. gbvrl77.seq - Viral sequence entries, part 77. 4743. gbvrl78.seq - Viral sequence entries, part 78. 4744. gbvrl79.seq - Viral sequence entries, part 79. 4745. gbvrl8.seq - Viral sequence entries, part 8. 4746. gbvrl80.seq - Viral sequence entries, part 80. 4747. gbvrl81.seq - Viral sequence entries, part 81. 4748. gbvrl82.seq - Viral sequence entries, part 82. 4749. gbvrl83.seq - Viral sequence entries, part 83. 4750. gbvrl84.seq - Viral sequence entries, part 84. 4751. gbvrl85.seq - Viral sequence entries, part 85. 4752. gbvrl86.seq - Viral sequence entries, part 86. 4753. gbvrl87.seq - Viral sequence entries, part 87. 4754. gbvrl88.seq - Viral sequence entries, part 88. 4755. gbvrl89.seq - Viral sequence entries, part 89. 4756. gbvrl9.seq - Viral sequence entries, part 9. 4757. gbvrl90.seq - Viral sequence entries, part 90. 4758. gbvrl91.seq - Viral sequence entries, part 91. 4759. gbvrl92.seq - Viral sequence entries, part 92. 4760. gbvrl93.seq - Viral sequence entries, part 93. 4761. gbvrl94.seq - Viral sequence entries, part 94. 4762. gbvrl95.seq - Viral sequence entries, part 95. 4763. gbvrl96.seq - Viral sequence entries, part 96. 4764. gbvrl97.seq - Viral sequence entries, part 97. 4765. gbvrl98.seq - Viral sequence entries, part 98. 4766. gbvrl99.seq - Viral sequence entries, part 99. 4767. gbvrt1.seq - Other vertebrate sequence entries, part 1. 4768. gbvrt10.seq - Other vertebrate sequence entries, part 10. 4769. gbvrt100.seq - Other vertebrate sequence entries, part 100. 4770. gbvrt101.seq - Other vertebrate sequence entries, part 101. 4771. gbvrt102.seq - Other vertebrate sequence entries, part 102. 4772. gbvrt103.seq - Other vertebrate sequence entries, part 103. 4773. gbvrt104.seq - Other vertebrate sequence entries, part 104. 4774. gbvrt105.seq - Other vertebrate sequence entries, part 105. 4775. gbvrt106.seq - Other vertebrate sequence entries, part 106. 4776. gbvrt107.seq - Other vertebrate sequence entries, part 107. 4777. gbvrt108.seq - Other vertebrate sequence entries, part 108. 4778. gbvrt109.seq - Other vertebrate sequence entries, part 109. 4779. gbvrt11.seq - Other vertebrate sequence entries, part 11. 4780. gbvrt110.seq - Other vertebrate sequence entries, part 110. 4781. gbvrt111.seq - Other vertebrate sequence entries, part 111. 4782. gbvrt112.seq - Other vertebrate sequence entries, part 112. 4783. gbvrt113.seq - Other vertebrate sequence entries, part 113. 4784. gbvrt114.seq - Other vertebrate sequence entries, part 114. 4785. gbvrt115.seq - Other vertebrate sequence entries, part 115. 4786. gbvrt116.seq - Other vertebrate sequence entries, part 116. 4787. gbvrt117.seq - Other vertebrate sequence entries, part 117. 4788. gbvrt118.seq - Other vertebrate sequence entries, part 118. 4789. gbvrt119.seq - Other vertebrate sequence entries, part 119. 4790. gbvrt12.seq - Other vertebrate sequence entries, part 12. 4791. gbvrt120.seq - Other vertebrate sequence entries, part 120. 4792. gbvrt121.seq - Other vertebrate sequence entries, part 121. 4793. gbvrt122.seq - Other vertebrate sequence entries, part 122. 4794. gbvrt123.seq - Other vertebrate sequence entries, part 123. 4795. gbvrt124.seq - Other vertebrate sequence entries, part 124. 4796. gbvrt125.seq - Other vertebrate sequence entries, part 125. 4797. gbvrt126.seq - Other vertebrate sequence entries, part 126. 4798. gbvrt127.seq - Other vertebrate sequence entries, part 127. 4799. gbvrt128.seq - Other vertebrate sequence entries, part 128. 4800. gbvrt129.seq - Other vertebrate sequence entries, part 129. 4801. gbvrt13.seq - Other vertebrate sequence entries, part 13. 4802. gbvrt130.seq - Other vertebrate sequence entries, part 130. 4803. gbvrt131.seq - Other vertebrate sequence entries, part 131. 4804. gbvrt132.seq - Other vertebrate sequence entries, part 132. 4805. gbvrt133.seq - Other vertebrate sequence entries, part 133. 4806. gbvrt134.seq - Other vertebrate sequence entries, part 134. 4807. gbvrt135.seq - Other vertebrate sequence entries, part 135. 4808. gbvrt136.seq - Other vertebrate sequence entries, part 136. 4809. gbvrt137.seq - Other vertebrate sequence entries, part 137. 4810. gbvrt138.seq - Other vertebrate sequence entries, part 138. 4811. gbvrt139.seq - Other vertebrate sequence entries, part 139. 4812. gbvrt14.seq - Other vertebrate sequence entries, part 14. 4813. gbvrt140.seq - Other vertebrate sequence entries, part 140. 4814. gbvrt141.seq - Other vertebrate sequence entries, part 141. 4815. gbvrt142.seq - Other vertebrate sequence entries, part 142. 4816. gbvrt143.seq - Other vertebrate sequence entries, part 143. 4817. gbvrt144.seq - Other vertebrate sequence entries, part 144. 4818. gbvrt145.seq - Other vertebrate sequence entries, part 145. 4819. gbvrt146.seq - Other vertebrate sequence entries, part 146. 4820. gbvrt147.seq - Other vertebrate sequence entries, part 147. 4821. gbvrt148.seq - Other vertebrate sequence entries, part 148. 4822. gbvrt149.seq - Other vertebrate sequence entries, part 149. 4823. gbvrt15.seq - Other vertebrate sequence entries, part 15. 4824. gbvrt150.seq - Other vertebrate sequence entries, part 150. 4825. gbvrt151.seq - Other vertebrate sequence entries, part 151. 4826. gbvrt152.seq - Other vertebrate sequence entries, part 152. 4827. gbvrt153.seq - Other vertebrate sequence entries, part 153. 4828. gbvrt154.seq - Other vertebrate sequence entries, part 154. 4829. gbvrt155.seq - Other vertebrate sequence entries, part 155. 4830. gbvrt156.seq - Other vertebrate sequence entries, part 156. 4831. gbvrt157.seq - Other vertebrate sequence entries, part 157. 4832. gbvrt158.seq - Other vertebrate sequence entries, part 158. 4833. gbvrt159.seq - Other vertebrate sequence entries, part 159. 4834. gbvrt16.seq - Other vertebrate sequence entries, part 16. 4835. gbvrt160.seq - Other vertebrate sequence entries, part 160. 4836. gbvrt161.seq - Other vertebrate sequence entries, part 161. 4837. gbvrt162.seq - Other vertebrate sequence entries, part 162. 4838. gbvrt163.seq - Other vertebrate sequence entries, part 163. 4839. gbvrt164.seq - Other vertebrate sequence entries, part 164. 4840. gbvrt165.seq - Other vertebrate sequence entries, part 165. 4841. gbvrt166.seq - Other vertebrate sequence entries, part 166. 4842. gbvrt167.seq - Other vertebrate sequence entries, part 167. 4843. gbvrt168.seq - Other vertebrate sequence entries, part 168. 4844. gbvrt169.seq - Other vertebrate sequence entries, part 169. 4845. gbvrt17.seq - Other vertebrate sequence entries, part 17. 4846. gbvrt170.seq - Other vertebrate sequence entries, part 170. 4847. gbvrt171.seq - Other vertebrate sequence entries, part 171. 4848. gbvrt172.seq - Other vertebrate sequence entries, part 172. 4849. gbvrt173.seq - Other vertebrate sequence entries, part 173. 4850. gbvrt174.seq - Other vertebrate sequence entries, part 174. 4851. gbvrt175.seq - Other vertebrate sequence entries, part 175. 4852. gbvrt176.seq - Other vertebrate sequence entries, part 176. 4853. gbvrt177.seq - Other vertebrate sequence entries, part 177. 4854. gbvrt178.seq - Other vertebrate sequence entries, part 178. 4855. gbvrt179.seq - Other vertebrate sequence entries, part 179. 4856. gbvrt18.seq - Other vertebrate sequence entries, part 18. 4857. gbvrt180.seq - Other vertebrate sequence entries, part 180. 4858. gbvrt181.seq - Other vertebrate sequence entries, part 181. 4859. gbvrt182.seq - Other vertebrate sequence entries, part 182. 4860. gbvrt183.seq - Other vertebrate sequence entries, part 183. 4861. gbvrt184.seq - Other vertebrate sequence entries, part 184. 4862. gbvrt185.seq - Other vertebrate sequence entries, part 185. 4863. gbvrt186.seq - Other vertebrate sequence entries, part 186. 4864. gbvrt187.seq - Other vertebrate sequence entries, part 187. 4865. gbvrt188.seq - Other vertebrate sequence entries, part 188. 4866. gbvrt189.seq - Other vertebrate sequence entries, part 189. 4867. gbvrt19.seq - Other vertebrate sequence entries, part 19. 4868. gbvrt190.seq - Other vertebrate sequence entries, part 190. 4869. gbvrt191.seq - Other vertebrate sequence entries, part 191. 4870. gbvrt192.seq - Other vertebrate sequence entries, part 192. 4871. gbvrt193.seq - Other vertebrate sequence entries, part 193. 4872. gbvrt194.seq - Other vertebrate sequence entries, part 194. 4873. gbvrt195.seq - Other vertebrate sequence entries, part 195. 4874. gbvrt196.seq - Other vertebrate sequence entries, part 196. 4875. gbvrt197.seq - Other vertebrate sequence entries, part 197. 4876. gbvrt198.seq - Other vertebrate sequence entries, part 198. 4877. gbvrt199.seq - Other vertebrate sequence entries, part 199. 4878. gbvrt2.seq - Other vertebrate sequence entries, part 2. 4879. gbvrt20.seq - Other vertebrate sequence entries, part 20. 4880. gbvrt200.seq - Other vertebrate sequence entries, part 200. 4881. gbvrt201.seq - Other vertebrate sequence entries, part 201. 4882. gbvrt202.seq - Other vertebrate sequence entries, part 202. 4883. gbvrt203.seq - Other vertebrate sequence entries, part 203. 4884. gbvrt204.seq - Other vertebrate sequence entries, part 204. 4885. gbvrt205.seq - Other vertebrate sequence entries, part 205. 4886. gbvrt206.seq - Other vertebrate sequence entries, part 206. 4887. gbvrt207.seq - Other vertebrate sequence entries, part 207. 4888. gbvrt208.seq - Other vertebrate sequence entries, part 208. 4889. gbvrt209.seq - Other vertebrate sequence entries, part 209. 4890. gbvrt21.seq - Other vertebrate sequence entries, part 21. 4891. gbvrt210.seq - Other vertebrate sequence entries, part 210. 4892. gbvrt211.seq - Other vertebrate sequence entries, part 211. 4893. gbvrt212.seq - Other vertebrate sequence entries, part 212. 4894. gbvrt213.seq - Other vertebrate sequence entries, part 213. 4895. gbvrt214.seq - Other vertebrate sequence entries, part 214. 4896. gbvrt215.seq - Other vertebrate sequence entries, part 215. 4897. gbvrt216.seq - Other vertebrate sequence entries, part 216. 4898. gbvrt217.seq - Other vertebrate sequence entries, part 217. 4899. gbvrt218.seq - Other vertebrate sequence entries, part 218. 4900. gbvrt219.seq - Other vertebrate sequence entries, part 219. 4901. gbvrt22.seq - Other vertebrate sequence entries, part 22. 4902. gbvrt220.seq - Other vertebrate sequence entries, part 220. 4903. gbvrt221.seq - Other vertebrate sequence entries, part 221. 4904. gbvrt222.seq - Other vertebrate sequence entries, part 222. 4905. gbvrt223.seq - Other vertebrate sequence entries, part 223. 4906. gbvrt224.seq - Other vertebrate sequence entries, part 224. 4907. gbvrt225.seq - Other vertebrate sequence entries, part 225. 4908. gbvrt226.seq - Other vertebrate sequence entries, part 226. 4909. gbvrt227.seq - Other vertebrate sequence entries, part 227. 4910. gbvrt228.seq - Other vertebrate sequence entries, part 228. 4911. gbvrt229.seq - Other vertebrate sequence entries, part 229. 4912. gbvrt23.seq - Other vertebrate sequence entries, part 23. 4913. gbvrt230.seq - Other vertebrate sequence entries, part 230. 4914. gbvrt231.seq - Other vertebrate sequence entries, part 231. 4915. gbvrt232.seq - Other vertebrate sequence entries, part 232. 4916. gbvrt233.seq - Other vertebrate sequence entries, part 233. 4917. gbvrt234.seq - Other vertebrate sequence entries, part 234. 4918. gbvrt235.seq - Other vertebrate sequence entries, part 235. 4919. gbvrt236.seq - Other vertebrate sequence entries, part 236. 4920. gbvrt237.seq - Other vertebrate sequence entries, part 237. 4921. gbvrt238.seq - Other vertebrate sequence entries, part 238. 4922. gbvrt239.seq - Other vertebrate sequence entries, part 239. 4923. gbvrt24.seq - Other vertebrate sequence entries, part 24. 4924. gbvrt240.seq - Other vertebrate sequence entries, part 240. 4925. gbvrt241.seq - Other vertebrate sequence entries, part 241. 4926. gbvrt242.seq - Other vertebrate sequence entries, part 242. 4927. gbvrt243.seq - Other vertebrate sequence entries, part 243. 4928. gbvrt244.seq - Other vertebrate sequence entries, part 244. 4929. gbvrt245.seq - Other vertebrate sequence entries, part 245. 4930. gbvrt246.seq - Other vertebrate sequence entries, part 246. 4931. gbvrt247.seq - Other vertebrate sequence entries, part 247. 4932. gbvrt248.seq - Other vertebrate sequence entries, part 248. 4933. gbvrt249.seq - Other vertebrate sequence entries, part 249. 4934. gbvrt25.seq - Other vertebrate sequence entries, part 25. 4935. gbvrt250.seq - Other vertebrate sequence entries, part 250. 4936. gbvrt251.seq - Other vertebrate sequence entries, part 251. 4937. gbvrt252.seq - Other vertebrate sequence entries, part 252. 4938. gbvrt253.seq - Other vertebrate sequence entries, part 253. 4939. gbvrt254.seq - Other vertebrate sequence entries, part 254. 4940. gbvrt255.seq - Other vertebrate sequence entries, part 255. 4941. gbvrt256.seq - Other vertebrate sequence entries, part 256. 4942. gbvrt257.seq - Other vertebrate sequence entries, part 257. 4943. gbvrt258.seq - Other vertebrate sequence entries, part 258. 4944. gbvrt259.seq - Other vertebrate sequence entries, part 259. 4945. gbvrt26.seq - Other vertebrate sequence entries, part 26. 4946. gbvrt260.seq - Other vertebrate sequence entries, part 260. 4947. gbvrt261.seq - Other vertebrate sequence entries, part 261. 4948. gbvrt262.seq - Other vertebrate sequence entries, part 262. 4949. gbvrt27.seq - Other vertebrate sequence entries, part 27. 4950. gbvrt28.seq - Other vertebrate sequence entries, part 28. 4951. gbvrt29.seq - Other vertebrate sequence entries, part 29. 4952. gbvrt3.seq - Other vertebrate sequence entries, part 3. 4953. gbvrt30.seq - Other vertebrate sequence entries, part 30. 4954. gbvrt31.seq - Other vertebrate sequence entries, part 31. 4955. gbvrt32.seq - Other vertebrate sequence entries, part 32. 4956. gbvrt33.seq - Other vertebrate sequence entries, part 33. 4957. gbvrt34.seq - Other vertebrate sequence entries, part 34. 4958. gbvrt35.seq - Other vertebrate sequence entries, part 35. 4959. gbvrt36.seq - Other vertebrate sequence entries, part 36. 4960. gbvrt37.seq - Other vertebrate sequence entries, part 37. 4961. gbvrt38.seq - Other vertebrate sequence entries, part 38. 4962. gbvrt39.seq - Other vertebrate sequence entries, part 39. 4963. gbvrt4.seq - Other vertebrate sequence entries, part 4. 4964. gbvrt40.seq - Other vertebrate sequence entries, part 40. 4965. gbvrt41.seq - Other vertebrate sequence entries, part 41. 4966. gbvrt42.seq - Other vertebrate sequence entries, part 42. 4967. gbvrt43.seq - Other vertebrate sequence entries, part 43. 4968. gbvrt44.seq - Other vertebrate sequence entries, part 44. 4969. gbvrt45.seq - Other vertebrate sequence entries, part 45. 4970. gbvrt46.seq - Other vertebrate sequence entries, part 46. 4971. gbvrt47.seq - Other vertebrate sequence entries, part 47. 4972. gbvrt48.seq - Other vertebrate sequence entries, part 48. 4973. gbvrt49.seq - Other vertebrate sequence entries, part 49. 4974. gbvrt5.seq - Other vertebrate sequence entries, part 5. 4975. gbvrt50.seq - Other vertebrate sequence entries, part 50. 4976. gbvrt51.seq - Other vertebrate sequence entries, part 51. 4977. gbvrt52.seq - Other vertebrate sequence entries, part 52. 4978. gbvrt53.seq - Other vertebrate sequence entries, part 53. 4979. gbvrt54.seq - Other vertebrate sequence entries, part 54. 4980. gbvrt55.seq - Other vertebrate sequence entries, part 55. 4981. gbvrt56.seq - Other vertebrate sequence entries, part 56. 4982. gbvrt57.seq - Other vertebrate sequence entries, part 57. 4983. gbvrt58.seq - Other vertebrate sequence entries, part 58. 4984. gbvrt59.seq - Other vertebrate sequence entries, part 59. 4985. gbvrt6.seq - Other vertebrate sequence entries, part 6. 4986. gbvrt60.seq - Other vertebrate sequence entries, part 60. 4987. gbvrt61.seq - Other vertebrate sequence entries, part 61. 4988. gbvrt62.seq - Other vertebrate sequence entries, part 62. 4989. gbvrt63.seq - Other vertebrate sequence entries, part 63. 4990. gbvrt64.seq - Other vertebrate sequence entries, part 64. 4991. gbvrt65.seq - Other vertebrate sequence entries, part 65. 4992. gbvrt66.seq - Other vertebrate sequence entries, part 66. 4993. gbvrt67.seq - Other vertebrate sequence entries, part 67. 4994. gbvrt68.seq - Other vertebrate sequence entries, part 68. 4995. gbvrt69.seq - Other vertebrate sequence entries, part 69. 4996. gbvrt7.seq - Other vertebrate sequence entries, part 7. 4997. gbvrt70.seq - Other vertebrate sequence entries, part 70. 4998. gbvrt71.seq - Other vertebrate sequence entries, part 71. 4999. gbvrt72.seq - Other vertebrate sequence entries, part 72. 5000. gbvrt73.seq - Other vertebrate sequence entries, part 73. 5001. gbvrt74.seq - Other vertebrate sequence entries, part 74. 5002. gbvrt75.seq - Other vertebrate sequence entries, part 75. 5003. gbvrt76.seq - Other vertebrate sequence entries, part 76. 5004. gbvrt77.seq - Other vertebrate sequence entries, part 77. 5005. gbvrt78.seq - Other vertebrate sequence entries, part 78. 5006. gbvrt79.seq - Other vertebrate sequence entries, part 79. 5007. gbvrt8.seq - Other vertebrate sequence entries, part 8. 5008. gbvrt80.seq - Other vertebrate sequence entries, part 80. 5009. gbvrt81.seq - Other vertebrate sequence entries, part 81. 5010. gbvrt82.seq - Other vertebrate sequence entries, part 82. 5011. gbvrt83.seq - Other vertebrate sequence entries, part 83. 5012. gbvrt84.seq - Other vertebrate sequence entries, part 84. 5013. gbvrt85.seq - Other vertebrate sequence entries, part 85. 5014. gbvrt86.seq - Other vertebrate sequence entries, part 86. 5015. gbvrt87.seq - Other vertebrate sequence entries, part 87. 5016. gbvrt88.seq - Other vertebrate sequence entries, part 88. 5017. gbvrt89.seq - Other vertebrate sequence entries, part 89. 5018. gbvrt9.seq - Other vertebrate sequence entries, part 9. 5019. gbvrt90.seq - Other vertebrate sequence entries, part 90. 5020. gbvrt91.seq - Other vertebrate sequence entries, part 91. 5021. gbvrt92.seq - Other vertebrate sequence entries, part 92. 5022. gbvrt93.seq - Other vertebrate sequence entries, part 93. 5023. gbvrt94.seq - Other vertebrate sequence entries, part 94. 5024. gbvrt95.seq - Other vertebrate sequence entries, part 95. 5025. gbvrt96.seq - Other vertebrate sequence entries, part 96. 5026. gbvrt97.seq - Other vertebrate sequence entries, part 97. 5027. gbvrt98.seq - Other vertebrate sequence entries, part 98. 5028. gbvrt99.seq - Other vertebrate sequence entries, part 99. Sequences in the CON division data files (gbcon*.seq) are constructed from other "traditional" sequence records, and are represented in a unique way. CON records do not contain any sequence data; instead, they utilize a CONTIG linetype with a join() statement which describes how component sequences can be assembled to form the larger constructed sequence. Records in the CON division do not contribute to GenBank Release statistics (Sections 2.2.6, 2.2.7, and 2.2.8), or to the overall release statistics presented in the header of these release notes. The GenBank README describes the CON division of GenBank in more detail: ftp://ftp.ncbi.nih.gov/genbank/README.genbank 2.2.5 File Sizes Uncompressed, the Release 261.0 flatfiles require roughly 5249 GB, including the sequence files and the *.txt files. The following table contains the approximate sizes of the individual files in this release. Since minor changes to some of the files might have occurred after these release notes were written, these sizes should not be used to determine file integrity; they are provided as an aid to planning only. File Size File Name 1300177991 gbbct1.seq 1494920342 gbbct10.seq 1498881052 gbbct100.seq 397935460 gbbct101.seq 1492628274 gbbct102.seq 372448970 gbbct103.seq 1496847708 gbbct104.seq 721671623 gbbct105.seq 1498272731 gbbct106.seq 185848277 gbbct107.seq 1490154918 gbbct108.seq 678882882 gbbct109.seq 632787129 gbbct11.seq 1492669401 gbbct110.seq 625464854 gbbct111.seq 1490523491 gbbct112.seq 536514463 gbbct113.seq 1491070358 gbbct114.seq 448505664 gbbct115.seq 1496990297 gbbct116.seq 1125413243 gbbct117.seq 1490530099 gbbct118.seq 447443024 gbbct119.seq 1491607760 gbbct12.seq 1499536717 gbbct120.seq 562512248 gbbct121.seq 1497991956 gbbct122.seq 1495060746 gbbct123.seq 771545814 gbbct124.seq 1484728519 gbbct125.seq 414251305 gbbct126.seq 1490750476 gbbct127.seq 468997883 gbbct128.seq 1494405796 gbbct129.seq 1026601278 gbbct13.seq 531174815 gbbct130.seq 1492175241 gbbct131.seq 590454241 gbbct132.seq 1490679638 gbbct133.seq 1489254937 gbbct134.seq 367961744 gbbct135.seq 1495797570 gbbct136.seq 899966862 gbbct137.seq 1498294763 gbbct138.seq 922218074 gbbct139.seq 1485503356 gbbct14.seq 1496611892 gbbct140.seq 1007638068 gbbct141.seq 1493345316 gbbct142.seq 902115658 gbbct143.seq 1499490395 gbbct144.seq 1141504836 gbbct145.seq 1499231508 gbbct146.seq 747719352 gbbct147.seq 1499001224 gbbct148.seq 1001747042 gbbct149.seq 633355554 gbbct15.seq 1498222451 gbbct150.seq 1490829057 gbbct151.seq 865844173 gbbct152.seq 1498776012 gbbct153.seq 1497222139 gbbct154.seq 274102356 gbbct155.seq 1497125673 gbbct156.seq 1046899210 gbbct157.seq 1498387011 gbbct158.seq 1496048870 gbbct159.seq 1493744829 gbbct16.seq 533194999 gbbct160.seq 1489350928 gbbct161.seq 738386261 gbbct162.seq 1491321589 gbbct163.seq 657854122 gbbct164.seq 1498529961 gbbct165.seq 1493582321 gbbct166.seq 730657693 gbbct167.seq 1480016405 gbbct168.seq 1492358675 gbbct169.seq 937819477 gbbct17.seq 533003198 gbbct170.seq 1488708282 gbbct171.seq 1300558107 gbbct172.seq 1496429019 gbbct173.seq 1496613807 gbbct174.seq 315596476 gbbct175.seq 1497524996 gbbct176.seq 1490742714 gbbct177.seq 707383380 gbbct178.seq 1491886745 gbbct179.seq 1494225724 gbbct18.seq 1090367906 gbbct180.seq 1495911281 gbbct181.seq 974620906 gbbct182.seq 1498912698 gbbct183.seq 795071608 gbbct184.seq 1485760910 gbbct185.seq 897604258 gbbct186.seq 1499804277 gbbct187.seq 665481717 gbbct188.seq 1495144042 gbbct189.seq 631580903 gbbct19.seq 514151316 gbbct190.seq 1495326621 gbbct191.seq 1311468007 gbbct192.seq 1496277978 gbbct193.seq 1493204870 gbbct194.seq 316723707 gbbct195.seq 1491509206 gbbct196.seq 579457920 gbbct197.seq 1499470825 gbbct198.seq 471560799 gbbct199.seq 394935368 gbbct2.seq 1497607124 gbbct20.seq 1493504285 gbbct200.seq 1496761902 gbbct201.seq 219408606 gbbct202.seq 1491330340 gbbct203.seq 1436307952 gbbct204.seq 1495174060 gbbct205.seq 711986648 gbbct206.seq 1488468408 gbbct207.seq 561392750 gbbct208.seq 1493393405 gbbct209.seq 421301045 gbbct21.seq 722443682 gbbct210.seq 1497585233 gbbct211.seq 1493658397 gbbct212.seq 291826581 gbbct213.seq 1498979274 gbbct214.seq 1492524373 gbbct215.seq 501938080 gbbct216.seq 1498112499 gbbct217.seq 666665926 gbbct218.seq 1487372977 gbbct219.seq 1491407646 gbbct22.seq 678685495 gbbct220.seq 1491240939 gbbct221.seq 1492339631 gbbct222.seq 688979203 gbbct223.seq 1499235015 gbbct224.seq 1491528190 gbbct225.seq 147315955 gbbct226.seq 1499120739 gbbct227.seq 1179025118 gbbct228.seq 1492340666 gbbct229.seq 839880629 gbbct23.seq 1489152014 gbbct230.seq 213003833 gbbct231.seq 1499470681 gbbct232.seq 832566854 gbbct233.seq 1493440129 gbbct234.seq 1429661414 gbbct235.seq 1495914531 gbbct236.seq 1046050574 gbbct237.seq 1498424623 gbbct238.seq 1067705511 gbbct239.seq 1497947347 gbbct24.seq 1497164566 gbbct240.seq 1495172022 gbbct241.seq 277933089 gbbct242.seq 1493163574 gbbct243.seq 1367307653 gbbct244.seq 1497755772 gbbct245.seq 1494492695 gbbct246.seq 445324933 gbbct247.seq 1499130394 gbbct248.seq 1321340826 gbbct249.seq 1483824105 gbbct25.seq 1498946086 gbbct250.seq 788829444 gbbct251.seq 1498455374 gbbct252.seq 816093969 gbbct253.seq 1493792682 gbbct254.seq 488070586 gbbct255.seq 1494989471 gbbct256.seq 605545293 gbbct257.seq 1497012099 gbbct258.seq 658647876 gbbct259.seq 678195163 gbbct26.seq 1498972629 gbbct260.seq 1104217490 gbbct261.seq 1497030717 gbbct262.seq 938533849 gbbct263.seq 1498737207 gbbct264.seq 1237317628 gbbct265.seq 1489210123 gbbct266.seq 564230255 gbbct267.seq 1494138925 gbbct268.seq 1042890797 gbbct269.seq 21439470 gbbct27.seq 1496045120 gbbct270.seq 1167694449 gbbct271.seq 1490380887 gbbct272.seq 565673882 gbbct273.seq 1496181634 gbbct274.seq 886813463 gbbct275.seq 1495035438 gbbct276.seq 1059442249 gbbct277.seq 1496367291 gbbct278.seq 1464921705 gbbct279.seq 38705584 gbbct28.seq 1498515801 gbbct280.seq 929225517 gbbct281.seq 1492214165 gbbct282.seq 1491975131 gbbct283.seq 621987039 gbbct284.seq 1489375741 gbbct285.seq 1150916894 gbbct286.seq 1498196213 gbbct287.seq 863342560 gbbct288.seq 1495486456 gbbct289.seq 1494134189 gbbct29.seq 1495032658 gbbct290.seq 376494284 gbbct291.seq 1492611368 gbbct292.seq 716258261 gbbct293.seq 1497550366 gbbct294.seq 756839506 gbbct295.seq 1491163863 gbbct296.seq 1497527609 gbbct297.seq 196661163 gbbct298.seq 1496589259 gbbct299.seq 440968747 gbbct3.seq 480482223 gbbct30.seq 1481293944 gbbct300.seq 1499267670 gbbct301.seq 756402359 gbbct302.seq 1494682057 gbbct303.seq 746613899 gbbct304.seq 1498444856 gbbct305.seq 1494803960 gbbct306.seq 43389672 gbbct307.seq 1497713907 gbbct308.seq 1498515669 gbbct309.seq 1495481620 gbbct31.seq 663733782 gbbct310.seq 1499618143 gbbct311.seq 1489762250 gbbct312.seq 1498975093 gbbct313.seq 1152570777 gbbct314.seq 1499583507 gbbct315.seq 1356238458 gbbct316.seq 1490688868 gbbct317.seq 1498493113 gbbct318.seq 301820840 gbbct319.seq 1318993333 gbbct32.seq 1497190193 gbbct320.seq 651635497 gbbct321.seq 1488262692 gbbct322.seq 610803316 gbbct323.seq 1497463106 gbbct324.seq 636389968 gbbct325.seq 1489629962 gbbct326.seq 1155690383 gbbct327.seq 1499783178 gbbct328.seq 946349068 gbbct329.seq 1491827000 gbbct33.seq 1499583236 gbbct330.seq 1485779432 gbbct331.seq 27886221 gbbct332.seq 1476559086 gbbct333.seq 1453669035 gbbct334.seq 1488575393 gbbct335.seq 795442774 gbbct336.seq 1485163835 gbbct337.seq 998330304 gbbct338.seq 1498481607 gbbct339.seq 1340303157 gbbct34.seq 1019169566 gbbct340.seq 1491499388 gbbct341.seq 556367803 gbbct342.seq 1486811205 gbbct343.seq 581524100 gbbct344.seq 1490610259 gbbct345.seq 1343056388 gbbct346.seq 1480116152 gbbct347.seq 1188991800 gbbct348.seq 1493062071 gbbct349.seq 1481720049 gbbct35.seq 904122215 gbbct350.seq 1491702237 gbbct351.seq 1123591601 gbbct352.seq 1490108686 gbbct353.seq 1186070266 gbbct354.seq 1488256186 gbbct355.seq 639605210 gbbct356.seq 1496144270 gbbct357.seq 606941691 gbbct358.seq 1495823069 gbbct359.seq 1488663426 gbbct36.seq 1036692173 gbbct360.seq 1492085815 gbbct361.seq 1498437821 gbbct362.seq 120983575 gbbct363.seq 1493628126 gbbct364.seq 1414469298 gbbct365.seq 1494977151 gbbct366.seq 1198198047 gbbct367.seq 1497808225 gbbct368.seq 560939731 gbbct369.seq 124843461 gbbct37.seq 1487711180 gbbct370.seq 533776081 gbbct371.seq 1493205003 gbbct372.seq 883260300 gbbct373.seq 1489859319 gbbct374.seq 1495775240 gbbct375.seq 670427597 gbbct376.seq 1492795446 gbbct377.seq 1444027054 gbbct378.seq 1484153226 gbbct379.seq 1499697553 gbbct38.seq 1492426160 gbbct380.seq 253127756 gbbct381.seq 1496715646 gbbct382.seq 1494190640 gbbct383.seq 300187677 gbbct384.seq 1494342748 gbbct385.seq 1125312223 gbbct386.seq 1494621377 gbbct387.seq 674064343 gbbct388.seq 1497448367 gbbct389.seq 1492631339 gbbct39.seq 935171108 gbbct390.seq 1498129618 gbbct391.seq 1067620018 gbbct392.seq 1494081185 gbbct393.seq 1480423943 gbbct394.seq 1498327971 gbbct395.seq 825042690 gbbct396.seq 1497787037 gbbct397.seq 1453704711 gbbct398.seq 1494473542 gbbct399.seq 102364473 gbbct4.seq 246524366 gbbct40.seq 816943814 gbbct400.seq 1490372476 gbbct401.seq 1092919442 gbbct402.seq 1497628189 gbbct403.seq 645011304 gbbct404.seq 1497016057 gbbct405.seq 1032498246 gbbct406.seq 1491292664 gbbct407.seq 1108874242 gbbct408.seq 1495821074 gbbct409.seq 1481883826 gbbct41.seq 1412434458 gbbct410.seq 1489792857 gbbct411.seq 933052861 gbbct412.seq 1499188036 gbbct413.seq 1495124469 gbbct414.seq 895248208 gbbct415.seq 1491423178 gbbct416.seq 861726757 gbbct417.seq 1492616306 gbbct418.seq 1199367036 gbbct419.seq 957679690 gbbct42.seq 1496157364 gbbct420.seq 1490488781 gbbct421.seq 460649836 gbbct422.seq 1490365865 gbbct423.seq 718692260 gbbct424.seq 1495719164 gbbct425.seq 1494169041 gbbct426.seq 82649563 gbbct427.seq 1483095178 gbbct428.seq 579221392 gbbct429.seq 1494893823 gbbct43.seq 1498735730 gbbct430.seq 686792090 gbbct431.seq 1499451401 gbbct432.seq 725101778 gbbct433.seq 1495675291 gbbct434.seq 686923622 gbbct435.seq 1494276437 gbbct436.seq 588950854 gbbct437.seq 1493677587 gbbct438.seq 1318556027 gbbct439.seq 789309180 gbbct44.seq 305005446 gbbct440.seq 6898742 gbbct441.seq 14178459 gbbct442.seq 22823369 gbbct443.seq 44533895 gbbct444.seq 86687137 gbbct445.seq 168680242 gbbct446.seq 1496835762 gbbct447.seq 1499998005 gbbct448.seq 123190838 gbbct449.seq 1492617140 gbbct45.seq 1487452914 gbbct450.seq 709605416 gbbct451.seq 791763491 gbbct452.seq 586087659 gbbct453.seq 626268045 gbbct454.seq 544319902 gbbct455.seq 148407448 gbbct456.seq 1131332347 gbbct457.seq 1493448098 gbbct458.seq 1484833134 gbbct459.seq 1248491439 gbbct46.seq 291905719 gbbct460.seq 1496414481 gbbct461.seq 163883507 gbbct462.seq 1496860173 gbbct463.seq 615755463 gbbct464.seq 1499014700 gbbct465.seq 295118899 gbbct466.seq 1493319826 gbbct467.seq 590024546 gbbct468.seq 1492911744 gbbct469.seq 1496615283 gbbct47.seq 243476185 gbbct470.seq 1499570731 gbbct471.seq 592957716 gbbct472.seq 1494576725 gbbct473.seq 480923910 gbbct474.seq 51295351 gbbct475.seq 108039589 gbbct476.seq 1422472863 gbbct477.seq 1499997767 gbbct478.seq 1311069699 gbbct479.seq 886059368 gbbct48.seq 1493440049 gbbct480.seq 1498373587 gbbct481.seq 133617493 gbbct482.seq 1492246104 gbbct483.seq 619695519 gbbct484.seq 1498275274 gbbct485.seq 437799857 gbbct486.seq 1496629731 gbbct487.seq 1499999213 gbbct488.seq 282999747 gbbct489.seq 1496550412 gbbct49.seq 282580177 gbbct5.seq 290986411 gbbct50.seq 1492158968 gbbct51.seq 88462798 gbbct52.seq 1496025399 gbbct53.seq 253462586 gbbct54.seq 1498430551 gbbct55.seq 505162037 gbbct56.seq 1495242100 gbbct57.seq 675129841 gbbct58.seq 1494190005 gbbct59.seq 1497013058 gbbct6.seq 499172635 gbbct60.seq 1494455787 gbbct61.seq 330781299 gbbct62.seq 1499126002 gbbct63.seq 492171187 gbbct64.seq 1487505189 gbbct65.seq 1498199893 gbbct66.seq 394473051 gbbct67.seq 1491164687 gbbct68.seq 457611102 gbbct69.seq 1023080506 gbbct7.seq 1492313968 gbbct70.seq 1135423073 gbbct71.seq 1496704394 gbbct72.seq 893721813 gbbct73.seq 1493269352 gbbct74.seq 1412198748 gbbct75.seq 1498288490 gbbct76.seq 1496251773 gbbct77.seq 170803050 gbbct78.seq 1496560040 gbbct79.seq 1498918813 gbbct8.seq 475149035 gbbct80.seq 1491398737 gbbct81.seq 514295883 gbbct82.seq 1492454379 gbbct83.seq 676991923 gbbct84.seq 1497134590 gbbct85.seq 260568507 gbbct86.seq 1492255008 gbbct87.seq 292181906 gbbct88.seq 1494990751 gbbct89.seq 609385399 gbbct9.seq 574348826 gbbct90.seq 1490144676 gbbct91.seq 1212329207 gbbct92.seq 1499838833 gbbct93.seq 763934399 gbbct94.seq 1496833560 gbbct95.seq 748681224 gbbct96.seq 1494274774 gbbct97.seq 937765404 gbbct98.seq 1490173396 gbbct99.seq 18852986 gbchg.txt 1499995442 gbcon1.seq 1499999111 gbcon10.seq 1499995104 gbcon100.seq 576706802 gbcon101.seq 84953982 gbcon11.seq 1498405814 gbcon12.seq 318319660 gbcon13.seq 636023858 gbcon14.seq 126587923 gbcon15.seq 1028310251 gbcon16.seq 1444131052 gbcon17.seq 1500000000 gbcon18.seq 43306374 gbcon19.seq 94251153 gbcon2.seq 1278157868 gbcon20.seq 1271755654 gbcon21.seq 1386617844 gbcon22.seq 1177824385 gbcon23.seq 1240101010 gbcon24.seq 1337030035 gbcon25.seq 1299675944 gbcon26.seq 1261114939 gbcon27.seq 1188545530 gbcon28.seq 1365754855 gbcon29.seq 1498911488 gbcon3.seq 1387263027 gbcon30.seq 973412454 gbcon31.seq 174082386 gbcon32.seq 524074151 gbcon33.seq 704808554 gbcon34.seq 199583073 gbcon35.seq 1338812924 gbcon36.seq 1499950578 gbcon37.seq 200881441 gbcon38.seq 1499426434 gbcon39.seq 552185356 gbcon4.seq 167922947 gbcon40.seq 1134129251 gbcon41.seq 1500000194 gbcon42.seq 266937090 gbcon43.seq 1170180709 gbcon44.seq 1499998926 gbcon45.seq 775619178 gbcon46.seq 1304341687 gbcon47.seq 1133188230 gbcon48.seq 1499978784 gbcon49.seq 1498697728 gbcon5.seq 222300907 gbcon50.seq 1224503700 gbcon51.seq 45938911 gbcon52.seq 1330569622 gbcon53.seq 1499998104 gbcon54.seq 197763134 gbcon55.seq 1245238228 gbcon56.seq 969999009 gbcon57.seq 1250166723 gbcon58.seq 1402937643 gbcon59.seq 1494211664 gbcon6.seq 1183343266 gbcon60.seq 1023833403 gbcon61.seq 1411488563 gbcon62.seq 1380478657 gbcon63.seq 1266881900 gbcon64.seq 1078797150 gbcon65.seq 1499995975 gbcon66.seq 147611220 gbcon67.seq 1499963496 gbcon68.seq 336803374 gbcon69.seq 170068344 gbcon7.seq 1188837926 gbcon70.seq 1499974655 gbcon71.seq 275481498 gbcon72.seq 1499498042 gbcon73.seq 648844765 gbcon74.seq 1133518053 gbcon75.seq 1499997651 gbcon76.seq 298184095 gbcon77.seq 1478756571 gbcon78.seq 1382038697 gbcon79.seq 1499170121 gbcon8.seq 1499994450 gbcon80.seq 140170892 gbcon81.seq 1038927029 gbcon82.seq 1499970544 gbcon83.seq 1326569427 gbcon84.seq 1002937116 gbcon85.seq 1499994940 gbcon86.seq 4745738 gbcon87.seq 1499997187 gbcon88.seq 13882959 gbcon89.seq 1197352043 gbcon9.seq 1499997568 gbcon90.seq 277989840 gbcon91.seq 1499997568 gbcon92.seq 244697140 gbcon93.seq 1499911631 gbcon94.seq 345862390 gbcon95.seq 1499998327 gbcon96.seq 151429954 gbcon97.seq 1499987892 gbcon98.seq 234692153 gbcon99.seq 18307 gbdel.txt 1492468627 gbenv1.seq 506901903 gbenv10.seq 1192210508 gbenv11.seq 1499998905 gbenv12.seq 85400539 gbenv13.seq 1178756231 gbenv14.seq 1499998855 gbenv15.seq 47233015 gbenv16.seq 1193836854 gbenv17.seq 1336273984 gbenv18.seq 1473171021 gbenv19.seq 15345825 gbenv2.seq 1339459548 gbenv20.seq 1395970079 gbenv21.seq 1347344789 gbenv22.seq 1239590869 gbenv23.seq 1392834664 gbenv24.seq 1499998930 gbenv25.seq 160986033 gbenv26.seq 1499973638 gbenv27.seq 228109202 gbenv28.seq 1316354462 gbenv29.seq 1495179478 gbenv3.seq 1492554575 gbenv30.seq 1499999023 gbenv31.seq 494274878 gbenv32.seq 1497379922 gbenv33.seq 563114560 gbenv34.seq 1499350902 gbenv35.seq 555965397 gbenv36.seq 1498872495 gbenv37.seq 1470062868 gbenv38.seq 636903289 gbenv4.seq 1499184973 gbenv5.seq 1499996853 gbenv6.seq 484082209 gbenv7.seq 1055682345 gbenv8.seq 1499999103 gbenv9.seq 1499998040 gbest1.seq 1244432541 gbest10.seq 478350574 gbest100.seq 1499997280 gbest101.seq 462325791 gbest102.seq 1499999379 gbest103.seq 495993472 gbest104.seq 1499997040 gbest105.seq 525244681 gbest106.seq 1497312411 gbest107.seq 1499999347 gbest108.seq 521629824 gbest109.seq 1499997183 gbest11.seq 1499995864 gbest110.seq 576966057 gbest111.seq 1499998965 gbest112.seq 515152623 gbest113.seq 1499995627 gbest114.seq 561257795 gbest115.seq 1499996889 gbest116.seq 122786557 gbest117.seq 1499999273 gbest118.seq 554232080 gbest119.seq 549054583 gbest12.seq 1499998164 gbest120.seq 557205143 gbest121.seq 1499997807 gbest122.seq 512758961 gbest123.seq 1499999836 gbest124.seq 525506279 gbest125.seq 1485629481 gbest126.seq 1499998193 gbest127.seq 506412822 gbest128.seq 1499997315 gbest129.seq 1499998193 gbest13.seq 508751058 gbest130.seq 1499997805 gbest131.seq 425307183 gbest132.seq 1499997662 gbest133.seq 501891818 gbest134.seq 1469227149 gbest135.seq 1499998647 gbest136.seq 540445509 gbest137.seq 1499999161 gbest138.seq 494322862 gbest139.seq 487101889 gbest14.seq 1499999827 gbest140.seq 557621047 gbest141.seq 1499998388 gbest142.seq 469754446 gbest143.seq 1499998627 gbest144.seq 519798159 gbest145.seq 993935320 gbest146.seq 1499999348 gbest147.seq 507254809 gbest148.seq 1500000021 gbest149.seq 1499998954 gbest15.seq 445590247 gbest150.seq 1499998952 gbest151.seq 385956825 gbest152.seq 1499998826 gbest153.seq 523821485 gbest154.seq 1499997097 gbest155.seq 561909274 gbest156.seq 166258344 gbest157.seq 1499999473 gbest158.seq 588310541 gbest159.seq 465921293 gbest16.seq 1499997261 gbest160.seq 667269525 gbest161.seq 1499996792 gbest162.seq 656073978 gbest163.seq 1499999457 gbest164.seq 496989121 gbest165.seq 1499999635 gbest166.seq 68562748 gbest167.seq 1499996309 gbest168.seq 584714025 gbest169.seq 1499998232 gbest17.seq 1499997599 gbest170.seq 588027958 gbest171.seq 1499998506 gbest172.seq 549399505 gbest173.seq 1499998583 gbest174.seq 589133348 gbest175.seq 1499995926 gbest176.seq 624829775 gbest177.seq 828529101 gbest178.seq 1500000164 gbest179.seq 691425682 gbest18.seq 560913835 gbest180.seq 1499999145 gbest181.seq 410568558 gbest182.seq 1335975617 gbest183.seq 1261733551 gbest184.seq 1457029314 gbest185.seq 1305524661 gbest186.seq 1336201281 gbest187.seq 1188592078 gbest188.seq 1120643618 gbest189.seq 1499999283 gbest19.seq 1161929695 gbest190.seq 1146695156 gbest191.seq 1499997719 gbest192.seq 500797842 gbest193.seq 1499999707 gbest194.seq 523700291 gbest195.seq 170019681 gbest196.seq 1499997341 gbest197.seq 528584856 gbest198.seq 1499998621 gbest199.seq 434903673 gbest2.seq 689546565 gbest20.seq 568551449 gbest200.seq 1499998462 gbest201.seq 558919353 gbest202.seq 1499999440 gbest203.seq 536887953 gbest204.seq 1499999584 gbest205.seq 574354727 gbest206.seq 1499996590 gbest207.seq 208394234 gbest208.seq 1499999236 gbest209.seq 1500000157 gbest21.seq 595444718 gbest210.seq 1499997620 gbest211.seq 557673476 gbest212.seq 1499993891 gbest213.seq 644690195 gbest214.seq 1499998771 gbest215.seq 644817182 gbest216.seq 1499999913 gbest217.seq 520851900 gbest218.seq 174271459 gbest219.seq 477034729 gbest22.seq 1086399495 gbest220.seq 1076881402 gbest221.seq 1499997622 gbest222.seq 600064016 gbest223.seq 1499998945 gbest224.seq 511158642 gbest225.seq 1499999387 gbest226.seq 478133188 gbest227.seq 1499999379 gbest228.seq 418383466 gbest229.seq 856398835 gbest23.seq 1499998117 gbest230.seq 583428041 gbest231.seq 1499997412 gbest232.seq 533027091 gbest233.seq 1499996728 gbest234.seq 544540944 gbest235.seq 1499999416 gbest236.seq 512071277 gbest237.seq 1393300531 gbest238.seq 1111029018 gbest239.seq 1499997446 gbest24.seq 1050519718 gbest240.seq 1500000059 gbest241.seq 794336253 gbest242.seq 483805760 gbest25.seq 1499998922 gbest26.seq 464409095 gbest27.seq 1499999699 gbest28.seq 507844464 gbest29.seq 1499997198 gbest3.seq 1499999570 gbest30.seq 484327194 gbest31.seq 1499999068 gbest32.seq 510303762 gbest33.seq 123414980 gbest34.seq 1499998430 gbest35.seq 506586281 gbest36.seq 1499999189 gbest37.seq 547151633 gbest38.seq 1499997615 gbest39.seq 469427397 gbest4.seq 553867571 gbest40.seq 1499997028 gbest41.seq 472251879 gbest42.seq 1499999234 gbest43.seq 500143998 gbest44.seq 35244903 gbest45.seq 1500000064 gbest46.seq 527793872 gbest47.seq 1499999919 gbest48.seq 509963387 gbest49.seq 1500000133 gbest5.seq 1499999721 gbest50.seq 521815827 gbest51.seq 1499999782 gbest52.seq 18202008 gbest53.seq 1500000156 gbest54.seq 69236135 gbest55.seq 1223774214 gbest56.seq 1195302920 gbest57.seq 1499996399 gbest58.seq 585312182 gbest59.seq 475309806 gbest6.seq 1499999280 gbest60.seq 604731539 gbest61.seq 1500000230 gbest62.seq 529223178 gbest63.seq 1499996796 gbest64.seq 531776150 gbest65.seq 1499997515 gbest66.seq 324381871 gbest67.seq 1499996680 gbest68.seq 526476819 gbest69.seq 749994801 gbest7.seq 1499997847 gbest70.seq 511189553 gbest71.seq 1499999626 gbest72.seq 586437033 gbest73.seq 1499998278 gbest74.seq 620380874 gbest75.seq 1499997465 gbest76.seq 565990987 gbest77.seq 903618988 gbest78.seq 1499996645 gbest79.seq 1421196661 gbest8.seq 542966457 gbest80.seq 1499998408 gbest81.seq 542345429 gbest82.seq 1499999039 gbest83.seq 511589181 gbest84.seq 1499997738 gbest85.seq 529848771 gbest86.seq 1499998284 gbest87.seq 534252432 gbest88.seq 13610370 gbest89.seq 1262840416 gbest9.seq 1328952216 gbest90.seq 1321735732 gbest91.seq 1267561364 gbest92.seq 1270177636 gbest93.seq 1499998534 gbest94.seq 552065616 gbest95.seq 1499999987 gbest96.seq 547762830 gbest97.seq 1176578724 gbest98.seq 1499998766 gbest99.seq 1499998207 gbgss1.seq 1499998915 gbgss10.seq 6147876 gbgss100.seq 1499999483 gbgss101.seq 264587590 gbgss102.seq 1499998544 gbgss103.seq 429620282 gbgss104.seq 1499999258 gbgss105.seq 471953405 gbgss106.seq 1499999910 gbgss107.seq 419754980 gbgss108.seq 1499997195 gbgss109.seq 549831935 gbgss11.seq 518244381 gbgss110.seq 315572447 gbgss111.seq 1499999898 gbgss112.seq 467315305 gbgss113.seq 1499998567 gbgss114.seq 536130050 gbgss115.seq 1499997700 gbgss116.seq 522038817 gbgss117.seq 1499998777 gbgss118.seq 1959679 gbgss119.seq 1499997027 gbgss12.seq 1499999188 gbgss120.seq 499937285 gbgss121.seq 1477073385 gbgss122.seq 531335589 gbgss13.seq 1499998944 gbgss14.seq 475326860 gbgss15.seq 1499997653 gbgss16.seq 512509603 gbgss17.seq 1168552167 gbgss18.seq 1499999631 gbgss19.seq 541483221 gbgss2.seq 486877826 gbgss20.seq 1499999507 gbgss21.seq 443938499 gbgss22.seq 1499999209 gbgss23.seq 421053044 gbgss24.seq 1499998509 gbgss25.seq 427908143 gbgss26.seq 67665344 gbgss27.seq 1499998254 gbgss28.seq 492393725 gbgss29.seq 1499998711 gbgss3.seq 1499999477 gbgss30.seq 502274583 gbgss31.seq 1499999580 gbgss32.seq 419366282 gbgss33.seq 1499997062 gbgss34.seq 34855955 gbgss35.seq 1499998229 gbgss36.seq 492754354 gbgss37.seq 1499998171 gbgss38.seq 506753602 gbgss39.seq 555792228 gbgss4.seq 1499999418 gbgss40.seq 534174148 gbgss41.seq 1499999956 gbgss42.seq 465182812 gbgss43.seq 244248654 gbgss44.seq 1499997597 gbgss45.seq 545807577 gbgss46.seq 1499999893 gbgss47.seq 468704724 gbgss48.seq 1499997211 gbgss49.seq 1499999765 gbgss5.seq 542546055 gbgss50.seq 1499996778 gbgss51.seq 319646789 gbgss52.seq 1499997389 gbgss53.seq 605483733 gbgss54.seq 1499998554 gbgss55.seq 508922285 gbgss56.seq 1499998603 gbgss57.seq 451766711 gbgss58.seq 1499998515 gbgss59.seq 504918542 gbgss6.seq 529780376 gbgss60.seq 709677252 gbgss61.seq 1499997150 gbgss62.seq 514831545 gbgss63.seq 1499997106 gbgss64.seq 516779569 gbgss65.seq 1499997356 gbgss66.seq 502038098 gbgss67.seq 1499997413 gbgss68.seq 506828983 gbgss69.seq 1499999123 gbgss7.seq 373345547 gbgss70.seq 1499998660 gbgss71.seq 456782348 gbgss72.seq 1499999602 gbgss73.seq 458341813 gbgss74.seq 1499998619 gbgss75.seq 456856216 gbgss76.seq 1499999360 gbgss77.seq 364170901 gbgss78.seq 1215813295 gbgss79.seq 483126560 gbgss8.seq 1068461944 gbgss80.seq 1499999007 gbgss81.seq 549668532 gbgss82.seq 1499999044 gbgss83.seq 541154416 gbgss84.seq 1057630775 gbgss85.seq 1499998892 gbgss86.seq 496080781 gbgss87.seq 1499999252 gbgss88.seq 556326282 gbgss89.seq 826435019 gbgss9.seq 1499998428 gbgss90.seq 480820480 gbgss91.seq 1055215094 gbgss92.seq 1499998172 gbgss93.seq 483143456 gbgss94.seq 1499997645 gbgss95.seq 487712323 gbgss96.seq 1499998457 gbgss97.seq 475204364 gbgss98.seq 1499998809 gbgss99.seq 1499996974 gbhtc1.seq 331477785 gbhtc2.seq 940143493 gbhtc3.seq 715450895 gbhtc4.seq 1499970679 gbhtg1.seq 983504262 gbhtg10.seq 1267889827 gbhtg11.seq 1224664835 gbhtg12.seq 1265349521 gbhtg13.seq 1222991892 gbhtg14.seq 1234734328 gbhtg15.seq 1201837478 gbhtg16.seq 1205529949 gbhtg17.seq 1193774323 gbhtg18.seq 1161219247 gbhtg19.seq 1002667041 gbhtg2.seq 1252713164 gbhtg20.seq 1499944551 gbhtg21.seq 167070684 gbhtg22.seq 1499895691 gbhtg23.seq 468416937 gbhtg24.seq 1499942226 gbhtg25.seq 1417599358 gbhtg26.seq 1384967615 gbhtg27.seq 1383479100 gbhtg28.seq 1499949671 gbhtg29.seq 1499664703 gbhtg3.seq 1307517582 gbhtg30.seq 985106395 gbhtg4.seq 1499788429 gbhtg5.seq 974339073 gbhtg6.seq 1499819070 gbhtg7.seq 972857837 gbhtg8.seq 1499901770 gbhtg9.seq 1499997271 gbinv1.seq 94381501 gbinv10.seq 1182054227 gbinv100.seq 1386518936 gbinv1000.se 592071448 gbinv1001.se 1478483619 gbinv1002.se 530982066 gbinv1003.se 1462302633 gbinv1004.se 1488222098 gbinv1005.se 316978161 gbinv1006.se 1428447642 gbinv1007.se 748970586 gbinv1008.se 1447037924 gbinv1009.se 1499663239 gbinv101.seq 497131956 gbinv1010.se 1476470436 gbinv1011.se 723654522 gbinv1012.se 1488497897 gbinv1013.se 776269438 gbinv1014.se 1401070087 gbinv1015.se 1499767191 gbinv1016.se 26774817 gbinv1017.se 1374498134 gbinv1018.se 839509523 gbinv1019.se 133410444 gbinv102.seq 1429054226 gbinv1020.se 511579884 gbinv1021.se 1499769508 gbinv1022.se 285714929 gbinv1023.se 1488663552 gbinv1024.se 852471186 gbinv1025.se 1497639222 gbinv1026.se 940269075 gbinv1027.se 1372239390 gbinv1028.se 883953960 gbinv1029.se 548623487 gbinv103.seq 1414834225 gbinv1030.se 950346640 gbinv1031.se 1420677910 gbinv1032.se 1484572405 gbinv1033.se 302207567 gbinv1034.se 1471402527 gbinv1035.se 242824332 gbinv1036.se 1486519935 gbinv1037.se 516118654 gbinv1038.se 1443896344 gbinv1039.se 1489473163 gbinv104.seq 401590756 gbinv1040.se 1482551138 gbinv1041.se 379825603 gbinv1042.se 1471607599 gbinv1043.se 627240431 gbinv1044.se 1483677454 gbinv1045.se 534260145 gbinv1046.se 1470409794 gbinv1047.se 815630388 gbinv1048.se 1439612217 gbinv1049.se 510289823 gbinv105.seq 634137125 gbinv1050.se 1476799939 gbinv1051.se 690990472 gbinv1052.se 1446569710 gbinv1053.se 586322661 gbinv1054.se 1395031330 gbinv1055.se 705605596 gbinv1056.se 1433843315 gbinv1057.se 1481381148 gbinv1058.se 1499117349 gbinv1059.se 1499621237 gbinv106.seq 1497681677 gbinv1060.se 1372784832 gbinv1061.se 1479685759 gbinv1062.se 230078798 gbinv1063.se 1447125165 gbinv1064.se 1453467490 gbinv1065.se 206238518 gbinv1066.se 1487439186 gbinv1067.se 1224203052 gbinv1068.se 1357832111 gbinv1069.se 1479771613 gbinv107.seq 1403389078 gbinv1070.se 656055076 gbinv1071.se 1121741672 gbinv1072.se 1368086883 gbinv1073.se 686317202 gbinv1074.se 1399135479 gbinv1075.se 1499999238 gbinv1076.se 225740432 gbinv1077.se 305143352 gbinv108.seq 933854214 gbinv109.seq 1497689770 gbinv11.seq 1488026360 gbinv110.seq 1271327187 gbinv111.seq 1479772341 gbinv112.seq 1340183057 gbinv113.seq 1499959282 gbinv114.seq 1329791463 gbinv115.seq 1462835389 gbinv116.seq 1384398530 gbinv117.seq 1497744691 gbinv118.seq 1308739356 gbinv119.seq 613722125 gbinv12.seq 1480253815 gbinv120.seq 1356395603 gbinv121.seq 1465230120 gbinv122.seq 1346183566 gbinv123.seq 1483867182 gbinv124.seq 709054487 gbinv125.seq 1481355114 gbinv126.seq 1099028683 gbinv127.seq 1467670433 gbinv128.seq 1431209353 gbinv129.seq 1484460112 gbinv13.seq 1398298296 gbinv130.seq 1236029882 gbinv131.seq 1290962298 gbinv132.seq 1406619747 gbinv133.seq 1499567137 gbinv134.seq 855577670 gbinv135.seq 1394266063 gbinv136.seq 1499862021 gbinv137.seq 262234281 gbinv138.seq 1499966002 gbinv139.seq 1472044257 gbinv14.seq 218517075 gbinv140.seq 1499976501 gbinv141.seq 349146665 gbinv142.seq 1499822212 gbinv143.seq 1067070303 gbinv144.seq 1499998695 gbinv145.seq 567604836 gbinv146.seq 1499930839 gbinv147.seq 1122240846 gbinv148.seq 1468682724 gbinv149.seq 252009079 gbinv15.seq 1499999519 gbinv150.seq 89706920 gbinv151.seq 1499998320 gbinv152.seq 1135262858 gbinv153.seq 1499996884 gbinv154.seq 61144100 gbinv155.seq 1499999630 gbinv156.seq 681130891 gbinv157.seq 1234792748 gbinv158.seq 1127903322 gbinv159.seq 1411212874 gbinv16.seq 1370092189 gbinv160.seq 1071522534 gbinv161.seq 1491749892 gbinv162.seq 1482077488 gbinv163.seq 1428486102 gbinv164.seq 785387038 gbinv165.seq 1485746848 gbinv166.seq 950447013 gbinv167.seq 1496705944 gbinv168.seq 806848727 gbinv169.seq 472455130 gbinv17.seq 1493872622 gbinv170.seq 856340119 gbinv171.seq 1495116171 gbinv172.seq 830173484 gbinv173.seq 1462548683 gbinv174.seq 909175094 gbinv175.seq 1497255008 gbinv176.seq 948159065 gbinv177.seq 1168251683 gbinv178.seq 1001728647 gbinv179.seq 1463087102 gbinv18.seq 1484591726 gbinv180.seq 818944818 gbinv181.seq 1365196578 gbinv182.seq 656430488 gbinv183.seq 1469549148 gbinv184.seq 304494269 gbinv185.seq 1465424531 gbinv186.seq 326171717 gbinv187.seq 1481915194 gbinv188.seq 280017103 gbinv189.seq 382893064 gbinv19.seq 1461126854 gbinv190.seq 363343781 gbinv191.seq 1485699469 gbinv192.seq 492580334 gbinv193.seq 1484074546 gbinv194.seq 116340814 gbinv195.seq 1495860854 gbinv196.seq 1302209762 gbinv197.seq 1494942690 gbinv198.seq 1230663377 gbinv199.seq 1329032078 gbinv2.seq 1491326951 gbinv20.seq 1476437097 gbinv200.seq 444097657 gbinv201.seq 1475045916 gbinv202.seq 476777023 gbinv203.seq 1498005845 gbinv204.seq 1493093103 gbinv205.seq 30575344 gbinv206.seq 1498741126 gbinv207.seq 1488696868 gbinv208.seq 1451061108 gbinv209.seq 478394243 gbinv21.seq 1433437455 gbinv210.seq 262703171 gbinv211.seq 1491835196 gbinv212.seq 572555681 gbinv213.seq 1486458372 gbinv214.seq 1488217107 gbinv215.seq 1490465641 gbinv216.seq 1126350077 gbinv217.seq 1450277543 gbinv218.seq 1319901770 gbinv219.seq 1499969093 gbinv22.seq 1347201702 gbinv220.seq 1495706167 gbinv221.seq 421394198 gbinv222.seq 1469684916 gbinv223.seq 1112043464 gbinv224.seq 1495036534 gbinv225.seq 569557824 gbinv226.seq 1488360125 gbinv227.seq 678444187 gbinv228.seq 1478247791 gbinv229.seq 1121660607 gbinv23.seq 1499359194 gbinv230.seq 31554185 gbinv231.seq 1490085879 gbinv232.seq 1437458515 gbinv233.seq 72193350 gbinv234.seq 1498596856 gbinv235.seq 1144961759 gbinv236.seq 1146698377 gbinv237.seq 1036956058 gbinv238.seq 544459581 gbinv239.seq 1474452321 gbinv24.seq 1439602775 gbinv240.seq 1414400959 gbinv241.seq 216067261 gbinv242.seq 1474729500 gbinv243.seq 462939038 gbinv244.seq 1490427003 gbinv245.seq 571039519 gbinv246.seq 1485366449 gbinv247.seq 1448567597 gbinv248.seq 102290543 gbinv249.seq 1480929712 gbinv25.seq 1489524458 gbinv250.seq 512699050 gbinv251.seq 1395656265 gbinv252.seq 353041445 gbinv253.seq 1475607229 gbinv254.seq 367023446 gbinv255.seq 1498739195 gbinv256.seq 532000359 gbinv257.seq 1463905811 gbinv258.seq 342931318 gbinv259.seq 133188059 gbinv26.seq 1334667769 gbinv260.seq 538071589 gbinv261.seq 1485299655 gbinv262.seq 1082764780 gbinv263.seq 1440782442 gbinv264.seq 1136943111 gbinv265.seq 1495736706 gbinv266.seq 961513285 gbinv267.seq 1488706132 gbinv268.seq 421826050 gbinv269.seq 1449149144 gbinv27.seq 1417643381 gbinv270.seq 628806708 gbinv271.seq 1495082612 gbinv272.seq 562813715 gbinv273.seq 1337955552 gbinv274.seq 316192878 gbinv275.seq 1480026370 gbinv276.seq 532334004 gbinv277.seq 1411065540 gbinv278.seq 358679242 gbinv279.seq 192334243 gbinv28.seq 1429898216 gbinv280.seq 513013670 gbinv281.seq 1489350842 gbinv282.seq 334664659 gbinv283.seq 1492745138 gbinv284.seq 459659257 gbinv285.seq 1488662358 gbinv286.seq 329960301 gbinv287.seq 1498430713 gbinv288.seq 732438165 gbinv289.seq 1484791811 gbinv29.seq 1439672263 gbinv290.seq 856718137 gbinv291.seq 1494030148 gbinv292.seq 746097843 gbinv293.seq 1461000022 gbinv294.seq 831048648 gbinv295.seq 1414274849 gbinv296.seq 743540755 gbinv297.seq 1442985378 gbinv298.seq 1032623400 gbinv299.seq 1395011208 gbinv3.seq 416869708 gbinv30.seq 1449037838 gbinv300.seq 780441251 gbinv301.seq 1376944968 gbinv302.seq 347219848 gbinv303.seq 1484503489 gbinv304.seq 326435281 gbinv305.seq 1466419199 gbinv306.seq 282550709 gbinv307.seq 1481213432 gbinv308.seq 258304685 gbinv309.seq 1464142701 gbinv31.seq 1277131227 gbinv310.seq 321246481 gbinv311.seq 1385396260 gbinv312.seq 1369192781 gbinv313.seq 355690685 gbinv314.seq 1334142726 gbinv315.seq 1470257963 gbinv316.seq 509392891 gbinv317.seq 1484501940 gbinv318.seq 1358747502 gbinv319.seq 421068898 gbinv32.seq 312842405 gbinv320.seq 1421658161 gbinv321.seq 1476020704 gbinv322.seq 353309462 gbinv323.seq 1484355892 gbinv324.seq 1489535757 gbinv325.seq 124238895 gbinv326.seq 1352328131 gbinv327.seq 436474776 gbinv328.seq 1496458691 gbinv329.seq 1486507586 gbinv33.seq 713914519 gbinv330.seq 1439419495 gbinv331.seq 1197396451 gbinv332.seq 1495699303 gbinv333.seq 198554656 gbinv334.seq 1430730340 gbinv335.seq 1100445017 gbinv336.seq 1492366474 gbinv337.seq 586627743 gbinv338.seq 1471256820 gbinv339.seq 234808981 gbinv34.seq 1430049479 gbinv340.seq 346087558 gbinv341.seq 1442141266 gbinv342.seq 1446928519 gbinv343.seq 413523689 gbinv344.seq 1405608717 gbinv345.seq 640456621 gbinv346.seq 1240136015 gbinv347.seq 824225634 gbinv348.seq 1498393137 gbinv349.seq 1496624930 gbinv35.seq 542931472 gbinv350.seq 1491758087 gbinv351.seq 415614640 gbinv352.seq 1407782754 gbinv353.seq 500660668 gbinv354.seq 1443611809 gbinv355.seq 674031425 gbinv356.seq 1479938154 gbinv357.seq 1223421144 gbinv358.seq 1393719787 gbinv359.seq 204078060 gbinv36.seq 1482861531 gbinv360.seq 1479953476 gbinv361.seq 1209325387 gbinv362.seq 357962786 gbinv363.seq 1478381690 gbinv364.seq 421175954 gbinv365.seq 1447728294 gbinv366.seq 601914982 gbinv367.seq 1377783156 gbinv368.seq 902573572 gbinv369.seq 1478381151 gbinv37.seq 1426894153 gbinv370.seq 879778924 gbinv371.seq 1456066923 gbinv372.seq 1485824143 gbinv373.seq 141189064 gbinv374.seq 1472791262 gbinv375.seq 1442050951 gbinv376.seq 62656836 gbinv377.seq 1332945717 gbinv378.seq 1388892442 gbinv379.seq 277391075 gbinv38.seq 263791263 gbinv380.seq 1472556828 gbinv381.seq 1161993956 gbinv382.seq 1496224837 gbinv383.seq 1136721010 gbinv384.seq 1351507764 gbinv385.seq 1212772183 gbinv386.seq 1478983332 gbinv387.seq 1285994500 gbinv388.seq 1397715201 gbinv389.seq 1476172723 gbinv39.seq 982484040 gbinv390.seq 1471745710 gbinv391.seq 1469784460 gbinv392.seq 1490304786 gbinv393.seq 1139848900 gbinv394.seq 1459727733 gbinv395.seq 1406579342 gbinv396.seq 299175085 gbinv397.seq 1440324771 gbinv398.seq 634804122 gbinv399.seq 448191300 gbinv4.seq 241897360 gbinv40.seq 1476156793 gbinv400.seq 583773776 gbinv401.seq 1439439559 gbinv402.seq 590897802 gbinv403.seq 869432927 gbinv404.seq 2729769834 gbinv405.seq 1951209797 gbinv406.seq 1255792905 gbinv407.seq 898357564 gbinv408.seq 708100575 gbinv409.seq 1490840269 gbinv41.seq 1285990042 gbinv410.seq 862289027 gbinv411.seq 1443272573 gbinv412.seq 530056032 gbinv413.seq 1455700870 gbinv414.seq 289519034 gbinv415.seq 1496990721 gbinv416.seq 400324666 gbinv417.seq 1484025346 gbinv418.seq 234725199 gbinv419.seq 247566661 gbinv42.seq 1496745524 gbinv420.seq 219755877 gbinv421.seq 1473176550 gbinv422.seq 250139837 gbinv423.seq 1490216426 gbinv424.seq 245438038 gbinv425.seq 1421504392 gbinv426.seq 389948490 gbinv427.seq 1456740438 gbinv428.seq 332242654 gbinv429.seq 1483209265 gbinv43.seq 1495130891 gbinv430.seq 323405403 gbinv431.seq 1490655527 gbinv432.seq 314601722 gbinv433.seq 1485311445 gbinv434.seq 487095099 gbinv435.seq 1477554828 gbinv436.seq 615885650 gbinv437.seq 1493130408 gbinv438.seq 530737214 gbinv439.seq 247826516 gbinv44.seq 1497402423 gbinv440.seq 496766028 gbinv441.seq 1388528914 gbinv442.seq 382943701 gbinv443.seq 1377089717 gbinv444.seq 466011910 gbinv445.seq 1486110854 gbinv446.seq 345122102 gbinv447.seq 1485700745 gbinv448.seq 371367831 gbinv449.seq 1454074717 gbinv45.seq 1490043094 gbinv450.seq 289247942 gbinv451.seq 1428729976 gbinv452.seq 461978251 gbinv453.seq 1456581853 gbinv454.seq 126003479 gbinv455.seq 1480297042 gbinv456.seq 659311954 gbinv457.seq 1483437625 gbinv458.seq 586388071 gbinv459.seq 308472259 gbinv46.seq 1434897706 gbinv460.seq 660034729 gbinv461.seq 1485826608 gbinv462.seq 603779440 gbinv463.seq 1479700425 gbinv464.seq 565812317 gbinv465.seq 1493710702 gbinv466.seq 594270540 gbinv467.seq 1463114920 gbinv468.seq 961101608 gbinv469.seq 1332046634 gbinv47.seq 1468567869 gbinv470.seq 305294342 gbinv471.seq 1490770719 gbinv472.seq 876126175 gbinv473.seq 1485474619 gbinv474.seq 864451948 gbinv475.seq 1491363203 gbinv476.seq 866828741 gbinv477.seq 1340897041 gbinv478.seq 1497646503 gbinv479.seq 1030101320 gbinv48.seq 258588435 gbinv480.seq 1491648578 gbinv481.seq 422460477 gbinv482.seq 1469557945 gbinv483.seq 583322803 gbinv484.seq 1473586952 gbinv485.seq 512626556 gbinv486.seq 1484985659 gbinv487.seq 475110570 gbinv488.seq 1460025895 gbinv489.seq 1278053548 gbinv49.seq 480742216 gbinv490.seq 1418812379 gbinv491.seq 564645002 gbinv492.seq 1471722405 gbinv493.seq 546679836 gbinv494.seq 1464315366 gbinv495.seq 1488596506 gbinv496.seq 33427006 gbinv497.seq 1482877481 gbinv498.seq 1490889124 gbinv499.seq 1499532558 gbinv5.seq 650487144 gbinv50.seq 90441378 gbinv500.seq 1476477408 gbinv501.seq 480868562 gbinv502.seq 1464325796 gbinv503.seq 1338568836 gbinv504.seq 480059394 gbinv505.seq 1496895763 gbinv506.seq 342037518 gbinv507.seq 1484204605 gbinv508.seq 583980876 gbinv509.seq 1479054590 gbinv51.seq 1483484812 gbinv510.seq 433456206 gbinv511.seq 1498027089 gbinv512.seq 871379341 gbinv513.seq 1474039476 gbinv514.seq 920098493 gbinv515.seq 1484696408 gbinv516.seq 837001192 gbinv517.seq 1474790353 gbinv518.seq 971677762 gbinv519.seq 395398421 gbinv52.seq 1488358577 gbinv520.seq 988576390 gbinv521.seq 1493913751 gbinv522.seq 1337790154 gbinv523.seq 1482674926 gbinv524.seq 1393357388 gbinv525.seq 1483083030 gbinv526.seq 1347199508 gbinv527.seq 1390153087 gbinv528.seq 746496786 gbinv529.seq 1498186435 gbinv53.seq 1405110366 gbinv530.seq 490736101 gbinv531.seq 1495749208 gbinv532.seq 622207073 gbinv533.seq 1477768331 gbinv534.seq 442461420 gbinv535.seq 1496013057 gbinv536.seq 688690731 gbinv537.seq 1470664484 gbinv538.seq 735441637 gbinv539.seq 804909390 gbinv54.seq 1476090858 gbinv540.seq 674365936 gbinv541.seq 1473275233 gbinv542.seq 693591870 gbinv543.seq 1487352246 gbinv544.seq 349494731 gbinv545.seq 1490482586 gbinv546.seq 357339548 gbinv547.seq 1490279069 gbinv548.seq 380118841 gbinv549.seq 1489731441 gbinv55.seq 1482629494 gbinv550.seq 463916298 gbinv551.seq 1499586214 gbinv552.seq 876874119 gbinv553.seq 1489968687 gbinv554.seq 880061477 gbinv555.seq 1483044191 gbinv556.seq 1445615250 gbinv557.seq 403386358 gbinv558.seq 1426566075 gbinv559.seq 737332801 gbinv56.seq 1496817860 gbinv560.seq 223857543 gbinv561.seq 1483084573 gbinv562.seq 1474052588 gbinv563.seq 1471567223 gbinv564.seq 277662519 gbinv565.seq 1490877824 gbinv566.seq 234260561 gbinv567.seq 1397325934 gbinv568.seq 256237162 gbinv569.seq 907425481 gbinv57.seq 1466164356 gbinv570.seq 1480718563 gbinv571.seq 357065534 gbinv572.seq 1402593345 gbinv573.seq 417293984 gbinv574.seq 1477814635 gbinv575.seq 508922492 gbinv576.seq 1483472015 gbinv577.seq 307039761 gbinv578.seq 1481273614 gbinv579.seq 1490935406 gbinv58.seq 296798815 gbinv580.seq 1486500129 gbinv581.seq 298302504 gbinv582.seq 1341735347 gbinv583.seq 397549581 gbinv584.seq 1412631682 gbinv585.seq 337603338 gbinv586.seq 1486261599 gbinv587.seq 284851118 gbinv588.seq 1473724294 gbinv589.seq 544785313 gbinv59.seq 303768123 gbinv590.seq 1482098162 gbinv591.seq 1493449401 gbinv592.seq 186693625 gbinv593.seq 1474232828 gbinv594.seq 1456821165 gbinv595.seq 1288636561 gbinv596.seq 266841777 gbinv597.seq 1454813168 gbinv598.seq 598400576 gbinv599.seq 376885091 gbinv6.seq 1498785008 gbinv60.seq 1466601574 gbinv600.seq 442907988 gbinv601.seq 1456573641 gbinv602.seq 450458935 gbinv603.seq 1382342143 gbinv604.seq 1311359408 gbinv605.seq 1469464974 gbinv606.seq 1410573714 gbinv607.seq 172769725 gbinv608.seq 1475074278 gbinv609.seq 603657088 gbinv61.seq 1047572275 gbinv610.seq 1493941367 gbinv611.seq 1320519774 gbinv612.seq 1360414353 gbinv613.seq 549289075 gbinv614.seq 1433764026 gbinv615.seq 763646403 gbinv616.seq 1485107474 gbinv617.seq 383346236 gbinv618.seq 1496398328 gbinv619.seq 1479614288 gbinv62.seq 1405593335 gbinv620.seq 282285546 gbinv621.seq 1488486307 gbinv622.seq 139774590 gbinv623.seq 1486138248 gbinv624.seq 1495956862 gbinv625.seq 200580819 gbinv626.seq 1364141678 gbinv627.seq 1445853769 gbinv628.seq 464187387 gbinv629.seq 622090538 gbinv63.seq 1456011602 gbinv630.seq 1492021897 gbinv631.seq 1455513038 gbinv632.seq 607420336 gbinv633.seq 1457809849 gbinv634.seq 391487819 gbinv635.seq 1493536102 gbinv636.seq 405891713 gbinv637.seq 1494386441 gbinv638.seq 898135207 gbinv639.seq 1493842327 gbinv64.seq 1498797785 gbinv640.seq 420062004 gbinv641.seq 1487421789 gbinv642.seq 1359918423 gbinv643.seq 1446355632 gbinv644.seq 416385113 gbinv645.seq 1487964141 gbinv646.seq 622377949 gbinv647.seq 1330488898 gbinv648.seq 781012844 gbinv649.seq 1416177336 gbinv65.seq 1494742476 gbinv650.seq 359613667 gbinv651.seq 1495531651 gbinv652.seq 730071997 gbinv653.seq 882426802 gbinv654.seq 1391549013 gbinv655.seq 348223370 gbinv656.seq 1480519637 gbinv657.seq 1019143842 gbinv658.seq 1471388777 gbinv659.seq 119585423 gbinv66.seq 991065078 gbinv660.seq 1496789782 gbinv661.seq 916577370 gbinv662.seq 1328094736 gbinv663.seq 1293174012 gbinv664.seq 1487955820 gbinv665.seq 1058914911 gbinv666.seq 1315022365 gbinv667.seq 1495303361 gbinv668.seq 579569335 gbinv669.seq 1491972535 gbinv67.seq 1339680698 gbinv670.seq 1033801010 gbinv671.seq 1444565030 gbinv672.seq 506481911 gbinv673.seq 1431143280 gbinv674.seq 1487474924 gbinv675.seq 188364630 gbinv676.seq 1485486972 gbinv677.seq 1490457877 gbinv678.seq 143748171 gbinv679.seq 1373956709 gbinv68.seq 1480393377 gbinv680.seq 1455854789 gbinv681.seq 1430191058 gbinv682.seq 1491332213 gbinv683.seq 561720368 gbinv684.seq 1414146754 gbinv685.seq 1468601310 gbinv686.seq 1496553038 gbinv687.seq 896187392 gbinv688.seq 1455214357 gbinv689.seq 1475287000 gbinv69.seq 438664195 gbinv690.seq 1399948877 gbinv691.seq 664645337 gbinv692.seq 1479610876 gbinv693.seq 579018913 gbinv694.seq 1449261388 gbinv695.seq 641464470 gbinv696.seq 1478015439 gbinv697.seq 626080102 gbinv698.seq 1477053842 gbinv699.seq 1499042801 gbinv7.seq 813062851 gbinv70.seq 690971066 gbinv700.seq 1495345098 gbinv701.seq 533918523 gbinv702.seq 1363404622 gbinv703.seq 667544827 gbinv704.seq 1285411718 gbinv705.seq 442095444 gbinv706.seq 1439898744 gbinv707.seq 1235239831 gbinv708.seq 1456319177 gbinv709.seq 1484969356 gbinv71.seq 1193234454 gbinv710.seq 1313629197 gbinv711.seq 247425525 gbinv712.seq 1499807967 gbinv713.seq 404075944 gbinv714.seq 1490770554 gbinv715.seq 250762610 gbinv716.seq 1477609082 gbinv717.seq 547072028 gbinv718.seq 1461590078 gbinv719.seq 962155388 gbinv72.seq 759983319 gbinv720.seq 1435908609 gbinv721.seq 1484827153 gbinv722.seq 363604107 gbinv723.seq 1492209083 gbinv724.seq 367366059 gbinv725.seq 1499784421 gbinv726.seq 1104373125 gbinv727.seq 1493069824 gbinv728.seq 1215456811 gbinv729.seq 1491078346 gbinv73.seq 1486397133 gbinv730.seq 1246006985 gbinv731.seq 1247632781 gbinv732.seq 1469774909 gbinv733.seq 1226701605 gbinv734.seq 1306210890 gbinv735.seq 220144678 gbinv736.seq 1489544639 gbinv737.seq 1357913570 gbinv738.seq 1409850073 gbinv739.seq 928003060 gbinv74.seq 362223579 gbinv740.seq 1485497031 gbinv741.seq 491448177 gbinv742.seq 1492301654 gbinv743.seq 1204981677 gbinv744.seq 1498916960 gbinv745.seq 364756780 gbinv746.seq 1477226845 gbinv747.seq 422540971 gbinv748.seq 1466569383 gbinv749.seq 1498796751 gbinv75.seq 357530571 gbinv750.seq 1468997307 gbinv751.seq 1452486126 gbinv752.seq 1483476796 gbinv753.seq 1365877479 gbinv754.seq 178767394 gbinv755.seq 1489624021 gbinv756.seq 1487080559 gbinv757.seq 48852926 gbinv758.seq 1449894789 gbinv759.seq 867076088 gbinv76.seq 1395302798 gbinv760.seq 253522578 gbinv761.seq 1486157289 gbinv762.seq 696173833 gbinv763.seq 1458416908 gbinv764.seq 814939774 gbinv765.seq 1479062801 gbinv766.seq 738037935 gbinv767.seq 1217976463 gbinv768.seq 1046588527 gbinv769.seq 1495747298 gbinv77.seq 1422565381 gbinv770.seq 980137269 gbinv771.seq 1479037894 gbinv772.seq 1017570522 gbinv773.seq 1489307606 gbinv774.seq 980324643 gbinv775.seq 1483121377 gbinv776.seq 506324386 gbinv777.seq 1338271714 gbinv778.seq 670841568 gbinv779.seq 854906901 gbinv78.seq 1451740301 gbinv780.seq 488926617 gbinv781.seq 1460298086 gbinv782.seq 663465644 gbinv783.seq 1445208000 gbinv784.seq 699506754 gbinv785.seq 1479519514 gbinv786.seq 678461699 gbinv787.seq 1477356782 gbinv788.seq 774075524 gbinv789.seq 1488751864 gbinv79.seq 1498154189 gbinv790.seq 1033186830 gbinv791.seq 685164990 gbinv792.seq 1438661071 gbinv793.seq 1489193064 gbinv794.seq 450968981 gbinv795.seq 1488632788 gbinv796.seq 712610593 gbinv797.seq 1477656292 gbinv798.seq 785779795 gbinv799.seq 918439794 gbinv8.seq 819265355 gbinv80.seq 1425379516 gbinv800.seq 787269807 gbinv801.seq 1474254297 gbinv802.seq 1437961059 gbinv803.seq 256713283 gbinv804.seq 1484529176 gbinv805.seq 625639021 gbinv806.seq 1494007341 gbinv807.seq 862604065 gbinv808.seq 1469080509 gbinv809.seq 1492563121 gbinv81.seq 1221427361 gbinv810.seq 1447358318 gbinv811.seq 1267036515 gbinv812.seq 641221432 gbinv813.seq 1437902242 gbinv814.seq 882000540 gbinv815.seq 1149657667 gbinv816.seq 1212500670 gbinv817.seq 1061903042 gbinv818.seq 1279027406 gbinv819.seq 271764939 gbinv82.seq 1488412066 gbinv820.seq 946772983 gbinv821.seq 1469421448 gbinv822.seq 408517361 gbinv823.seq 1488068921 gbinv824.seq 1074331561 gbinv825.seq 1471446714 gbinv826.seq 1089245394 gbinv827.seq 1496624861 gbinv828.seq 363003470 gbinv829.seq 1499996709 gbinv83.seq 1486563514 gbinv830.seq 412890780 gbinv831.seq 1494065365 gbinv832.seq 418733099 gbinv833.seq 1475737261 gbinv834.seq 340704941 gbinv835.seq 1485085997 gbinv836.seq 1049160877 gbinv837.seq 1171084260 gbinv838.seq 339697667 gbinv839.seq 101558798 gbinv84.seq 1444118018 gbinv840.seq 591016312 gbinv841.seq 1496010311 gbinv842.seq 124374618 gbinv843.seq 1477313812 gbinv844.seq 1483445786 gbinv845.seq 91128417 gbinv846.seq 1338370292 gbinv847.seq 733987331 gbinv848.seq 1471879735 gbinv849.seq 1406802219 gbinv85.seq 1053677687 gbinv850.seq 671628694 gbinv851.seq 1388129956 gbinv852.seq 295588391 gbinv853.seq 1433770265 gbinv854.seq 476835269 gbinv855.seq 1433410472 gbinv856.seq 438228696 gbinv857.seq 1250726673 gbinv858.seq 611825037 gbinv859.seq 1182695720 gbinv86.seq 1493699074 gbinv860.seq 525660640 gbinv861.seq 1486072334 gbinv862.seq 322132118 gbinv863.seq 1402544732 gbinv864.seq 423016322 gbinv865.seq 1475530293 gbinv866.seq 1499027380 gbinv867.seq 1396587458 gbinv868.seq 1394302822 gbinv869.seq 1126276629 gbinv87.seq 528217521 gbinv870.seq 1466230627 gbinv871.seq 1343924683 gbinv872.seq 774782659 gbinv873.seq 1401591455 gbinv874.seq 1155865188 gbinv875.seq 837350261 gbinv876.seq 1441258603 gbinv877.seq 1462770311 gbinv878.seq 572595067 gbinv879.seq 1153105469 gbinv88.seq 1382009986 gbinv880.seq 608028412 gbinv881.seq 1380331263 gbinv882.seq 438520090 gbinv883.seq 1470077879 gbinv884.seq 783762965 gbinv885.seq 1176366200 gbinv886.seq 608322919 gbinv887.seq 1205408689 gbinv888.seq 1104142746 gbinv889.seq 1157048235 gbinv89.seq 1036632038 gbinv890.seq 923782898 gbinv891.seq 1217966648 gbinv892.seq 1082974717 gbinv893.seq 1128407176 gbinv894.seq 731766010 gbinv895.seq 1443670782 gbinv896.seq 922178852 gbinv897.seq 1347794179 gbinv898.seq 747649030 gbinv899.seq 1493251903 gbinv9.seq 1191511440 gbinv90.seq 1460306287 gbinv900.seq 900427213 gbinv901.seq 1477710109 gbinv902.seq 792551859 gbinv903.seq 1409054861 gbinv904.seq 896382991 gbinv905.seq 1269865578 gbinv906.seq 1301155539 gbinv907.seq 943349247 gbinv908.seq 878734428 gbinv909.seq 1247541920 gbinv91.seq 874599051 gbinv910.seq 872525010 gbinv911.seq 810605264 gbinv912.seq 791733648 gbinv913.seq 789407447 gbinv914.seq 782472280 gbinv915.seq 1478877159 gbinv916.seq 1425054466 gbinv917.seq 1232428257 gbinv918.seq 1159914346 gbinv919.seq 1499997818 gbinv92.seq 1489477121 gbinv920.seq 427244069 gbinv921.seq 1497897156 gbinv922.seq 548539976 gbinv923.seq 1436968217 gbinv924.seq 933768365 gbinv925.seq 1491275346 gbinv926.seq 869474520 gbinv927.seq 1450231548 gbinv928.seq 1342340551 gbinv929.seq 681259685 gbinv93.seq 1451776732 gbinv930.seq 540560242 gbinv931.seq 1476017219 gbinv932.seq 983921298 gbinv933.seq 1447912985 gbinv934.seq 1437245729 gbinv935.seq 1480916438 gbinv936.seq 561131412 gbinv937.seq 1477416158 gbinv938.seq 815721365 gbinv939.seq 955572480 gbinv94.seq 1489540966 gbinv940.seq 649631068 gbinv941.seq 1486418220 gbinv942.seq 1485766453 gbinv943.seq 299017541 gbinv944.seq 1447293450 gbinv945.seq 1424436854 gbinv946.seq 555359826 gbinv947.seq 1490369912 gbinv948.seq 1454124707 gbinv949.seq 289059083 gbinv95.seq 236657036 gbinv950.seq 1410657895 gbinv951.seq 1499881679 gbinv952.seq 352677392 gbinv953.seq 1494772634 gbinv954.seq 688582722 gbinv955.seq 1499431451 gbinv956.seq 805871519 gbinv957.seq 1453297195 gbinv958.seq 773837307 gbinv959.seq 54983086 gbinv96.seq 1335852192 gbinv960.seq 527825304 gbinv961.seq 1476565583 gbinv962.seq 680958925 gbinv963.seq 1463772379 gbinv964.seq 562324008 gbinv965.seq 1496442964 gbinv966.seq 559742644 gbinv967.seq 1479845810 gbinv968.seq 358265933 gbinv969.seq 52942590 gbinv97.seq 1445692355 gbinv970.seq 591239914 gbinv971.seq 1409906324 gbinv972.seq 564609714 gbinv973.seq 1375758712 gbinv974.seq 814258094 gbinv975.seq 1465790531 gbinv976.seq 710509361 gbinv977.seq 1332386478 gbinv978.seq 1007465375 gbinv979.seq 157078175 gbinv98.seq 1483491452 gbinv980.seq 1218171606 gbinv981.seq 1446948614 gbinv982.seq 1107260814 gbinv983.seq 1488515265 gbinv984.seq 1090427935 gbinv985.seq 1473901953 gbinv986.seq 1041928661 gbinv987.seq 1441427152 gbinv988.seq 1386697076 gbinv989.seq 768189501 gbinv99.seq 608783665 gbinv990.seq 1499618036 gbinv991.seq 297893234 gbinv992.seq 1476443088 gbinv993.seq 573065947 gbinv994.seq 1191529685 gbinv995.seq 1176457428 gbinv996.seq 1118724487 gbinv997.seq 1448943866 gbinv998.seq 374045261 gbinv999.seq 1299915269 gbmam1.seq 417714201 gbmam10.seq 1453876757 gbmam100.seq 1208505762 gbmam101.seq 1376302879 gbmam102.seq 1359500385 gbmam103.seq 238286100 gbmam104.seq 1395204913 gbmam105.seq 1360844519 gbmam106.seq 1426041019 gbmam107.seq 981344570 gbmam108.seq 1452412349 gbmam109.seq 1454600951 gbmam11.seq 1422874419 gbmam110.seq 408481718 gbmam111.seq 1493203952 gbmam112.seq 306899300 gbmam113.seq 1348484898 gbmam114.seq 529814629 gbmam115.seq 1479589965 gbmam116.seq 1003077901 gbmam117.seq 1442404259 gbmam118.seq 834292000 gbmam119.seq 1491732579 gbmam12.seq 1482830562 gbmam120.seq 1108515895 gbmam121.seq 1356418005 gbmam122.seq 1450451476 gbmam123.seq 198338337 gbmam124.seq 1472637635 gbmam125.seq 1481463696 gbmam126.seq 142270519 gbmam127.seq 1405794202 gbmam128.seq 1483682369 gbmam129.seq 132948661 gbmam13.seq 277715394 gbmam130.seq 1432986514 gbmam131.seq 919898592 gbmam132.seq 1355826661 gbmam133.seq 1012666587 gbmam134.seq 1492187184 gbmam135.seq 927075547 gbmam136.seq 1474648453 gbmam137.seq 442335081 gbmam138.seq 1494089828 gbmam139.seq 1443615542 gbmam14.seq 503907043 gbmam140.seq 1318911633 gbmam141.seq 610345039 gbmam142.seq 1338335661 gbmam143.seq 731448449 gbmam144.seq 1387099171 gbmam145.seq 546743394 gbmam146.seq 1323529426 gbmam147.seq 713158415 gbmam148.seq 1443855143 gbmam149.seq 531711770 gbmam15.seq 570951834 gbmam150.seq 1265660771 gbmam151.seq 845102809 gbmam152.seq 1479725176 gbmam153.seq 768765653 gbmam154.seq 1499323699 gbmam155.seq 993450991 gbmam156.seq 1492397698 gbmam157.seq 933948278 gbmam158.seq 1395293696 gbmam159.seq 1417477477 gbmam16.seq 1410692302 gbmam160.seq 560290656 gbmam17.seq 1491564169 gbmam18.seq 313468224 gbmam19.seq 477148353 gbmam2.seq 1499406394 gbmam20.seq 1062035477 gbmam21.seq 1485199324 gbmam22.seq 1304037351 gbmam23.seq 33997170 gbmam24.seq 9943311 gbmam25.seq 43988539 gbmam26.seq 91321391 gbmam27.seq 88809559 gbmam28.seq 6368091 gbmam29.seq 1469194323 gbmam3.seq 21014407 gbmam30.seq 449670982 gbmam31.seq 1459771977 gbmam32.seq 1181085315 gbmam33.seq 1499997204 gbmam34.seq 925707953 gbmam35.seq 839494897 gbmam36.seq 774395849 gbmam37.seq 1382131671 gbmam38.seq 1055303580 gbmam39.seq 505262074 gbmam4.seq 1486708589 gbmam40.seq 801027075 gbmam41.seq 1455155074 gbmam42.seq 830552794 gbmam43.seq 1430736721 gbmam44.seq 988623453 gbmam45.seq 1463225227 gbmam46.seq 1040235734 gbmam47.seq 1494406931 gbmam48.seq 1375647073 gbmam49.seq 82858357 gbmam5.seq 1383327549 gbmam50.seq 1473290653 gbmam51.seq 427109587 gbmam52.seq 1378869423 gbmam53.seq 1482299281 gbmam54.seq 326072158 gbmam55.seq 1427810688 gbmam56.seq 1423540895 gbmam57.seq 408291238 gbmam58.seq 1416530939 gbmam59.seq 71296832 gbmam6.seq 1476987068 gbmam60.seq 508139671 gbmam61.seq 1363509726 gbmam62.seq 287465617 gbmam63.seq 1433940672 gbmam64.seq 390298771 gbmam65.seq 1374324242 gbmam66.seq 733536654 gbmam67.seq 1468553408 gbmam68.seq 405323312 gbmam69.seq 22560540 gbmam7.seq 1426269234 gbmam70.seq 733331809 gbmam71.seq 1407233551 gbmam72.seq 980079942 gbmam73.seq 1443508442 gbmam74.seq 780606100 gbmam75.seq 1424198150 gbmam76.seq 345212223 gbmam77.seq 1483991847 gbmam78.seq 394044617 gbmam79.seq 1268287 gbmam8.seq 1407365695 gbmam80.seq 225944986 gbmam81.seq 1441479785 gbmam82.seq 469953642 gbmam83.seq 1344156069 gbmam84.seq 375382416 gbmam85.seq 1405793836 gbmam86.seq 329856861 gbmam87.seq 1451013217 gbmam88.seq 268468304 gbmam89.seq 1344982518 gbmam9.seq 1414660891 gbmam90.seq 465828460 gbmam91.seq 1456302791 gbmam92.seq 544855283 gbmam93.seq 1316003894 gbmam94.seq 825457176 gbmam95.seq 1465506656 gbmam96.seq 834197259 gbmam97.seq 1442051765 gbmam98.seq 821884488 gbmam99.seq 4852556 gbnew.txt 1061257253 gbpat1.seq 666881621 gbpat10.seq 1499998960 gbpat100.seq 187733203 gbpat101.seq 1481546501 gbpat102.seq 1385155853 gbpat103.seq 1435129832 gbpat104.seq 1107869813 gbpat105.seq 1163545267 gbpat106.seq 1415198367 gbpat107.seq 1499993135 gbpat108.seq 256684826 gbpat109.seq 1213212603 gbpat11.seq 906229344 gbpat12.seq 1126662943 gbpat13.seq 1500000073 gbpat14.seq 140158506 gbpat15.seq 1499513380 gbpat16.seq 638473861 gbpat17.seq 1499999263 gbpat18.seq 87884373 gbpat19.seq 1419247207 gbpat2.seq 1499999022 gbpat20.seq 130974440 gbpat21.seq 1185008925 gbpat22.seq 1137264062 gbpat23.seq 1429497634 gbpat24.seq 821477812 gbpat25.seq 1306528109 gbpat26.seq 1144915269 gbpat27.seq 726234433 gbpat28.seq 1309498169 gbpat29.seq 1317353015 gbpat3.seq 1259593484 gbpat30.seq 1036781105 gbpat31.seq 974766108 gbpat32.seq 831709767 gbpat33.seq 812347725 gbpat34.seq 1499998610 gbpat35.seq 205998958 gbpat36.seq 955869012 gbpat37.seq 752680082 gbpat38.seq 1083033126 gbpat39.seq 1179042848 gbpat4.seq 998235851 gbpat40.seq 1499998334 gbpat41.seq 228716814 gbpat42.seq 1499999586 gbpat43.seq 335512964 gbpat44.seq 1210705682 gbpat45.seq 1174066991 gbpat46.seq 1499994102 gbpat47.seq 8881342 gbpat48.seq 882583557 gbpat49.seq 1062753836 gbpat5.seq 1499991636 gbpat50.seq 556648641 gbpat51.seq 1208428269 gbpat52.seq 1059360857 gbpat53.seq 1488851256 gbpat54.seq 1028329766 gbpat55.seq 885160478 gbpat56.seq 1148512936 gbpat57.seq 814549393 gbpat58.seq 1409506237 gbpat59.seq 1422338371 gbpat6.seq 1125979685 gbpat60.seq 1499995298 gbpat61.seq 669882508 gbpat62.seq 926362020 gbpat63.seq 1499969755 gbpat64.seq 353671289 gbpat65.seq 1291260619 gbpat66.seq 1499999221 gbpat67.seq 102925314 gbpat68.seq 1499996917 gbpat69.seq 1499999663 gbpat7.seq 801705817 gbpat70.seq 1499999478 gbpat71.seq 319789165 gbpat72.seq 1500000152 gbpat73.seq 13001800 gbpat74.seq 1499998093 gbpat75.seq 84107819 gbpat76.seq 1499999641 gbpat77.seq 39679778 gbpat78.seq 1499999591 gbpat79.seq 347876060 gbpat8.seq 595878571 gbpat80.seq 1500000234 gbpat81.seq 590173332 gbpat82.seq 1499995529 gbpat83.seq 504087653 gbpat84.seq 1499998928 gbpat85.seq 478202128 gbpat86.seq 1321704167 gbpat87.seq 1350590572 gbpat88.seq 1418827872 gbpat89.seq 1499558017 gbpat9.seq 1335688240 gbpat90.seq 1499999385 gbpat91.seq 361475056 gbpat92.seq 1336382704 gbpat93.seq 1366896121 gbpat94.seq 1388591258 gbpat95.seq 1498667620 gbpat96.seq 1021954216 gbpat97.seq 1499998729 gbpat98.seq 988150300 gbpat99.seq 1500000000 gbphg1.seq 1499964240 gbphg2.seq 382368236 gbphg3.seq 1499915935 gbpln1.seq 1065209035 gbpln10.seq 1490746088 gbpln100.seq 771195581 gbpln1000.se 1452626437 gbpln1001.se 1452862185 gbpln1002.se 666670554 gbpln1003.se 841954477 gbpln1004.se 801058908 gbpln1005.se 777293273 gbpln1006.se 1485779606 gbpln1007.se 1452913123 gbpln1008.se 836617455 gbpln1009.se 928539912 gbpln101.seq 790837080 gbpln1010.se 777459211 gbpln1011.se 747254822 gbpln1012.se 706272554 gbpln1013.se 1454781570 gbpln1014.se 839842771 gbpln1015.se 793797446 gbpln1016.se 776363695 gbpln1017.se 1456772382 gbpln1018.se 1466569984 gbpln1019.se 1454921806 gbpln102.seq 845148876 gbpln1020.se 804833075 gbpln1021.se 778470840 gbpln1022.se 1481006671 gbpln1023.se 1474068833 gbpln1024.se 794180240 gbpln1025.se 774312133 gbpln1026.se 1457303715 gbpln1027.se 835115958 gbpln1028.se 1457626965 gbpln1029.se 838249670 gbpln103.seq 836718376 gbpln1030.se 801816184 gbpln1031.se 780710757 gbpln1032.se 754364739 gbpln1033.se 733491153 gbpln1034.se 1468374098 gbpln1035.se 835020955 gbpln1036.se 794498288 gbpln1037.se 775035874 gbpln1038.se 1474921682 gbpln1039.se 1492027099 gbpln104.seq 1459702205 gbpln1040.se 836763144 gbpln1041.se 794319485 gbpln1042.se 771563218 gbpln1043.se 1442336042 gbpln1044.se 796083444 gbpln1045.se 665841375 gbpln1046.se 835744193 gbpln1047.se 793808494 gbpln1048.se 775366859 gbpln1049.se 456902623 gbpln105.seq 744449290 gbpln1050.se 708201546 gbpln1051.se 1461461120 gbpln1052.se 839340148 gbpln1053.se 793588555 gbpln1054.se 778845059 gbpln1055.se 1471514124 gbpln1056.se 1460672453 gbpln1057.se 847689175 gbpln1058.se 797030463 gbpln1059.se 1464211798 gbpln106.seq 776617524 gbpln1060.se 1450233858 gbpln1061.se 1469651463 gbpln1062.se 834034797 gbpln1063.se 795540701 gbpln1064.se 776376885 gbpln1065.se 1448905128 gbpln1066.se 1457656304 gbpln1067.se 833009352 gbpln1068.se 797524540 gbpln1069.se 1007418262 gbpln107.seq 773297930 gbpln1070.se 1451244889 gbpln1071.se 1454193216 gbpln1072.se 830169429 gbpln1073.se 793310457 gbpln1074.se 773560290 gbpln1075.se 1446231891 gbpln1076.se 1450937303 gbpln1077.se 835938341 gbpln1078.se 795056321 gbpln1079.se 1496233196 gbpln108.seq 770765157 gbpln1080.se 1475561524 gbpln1081.se 1466579245 gbpln1082.se 829099164 gbpln1083.se 790989379 gbpln1084.se 773398673 gbpln1085.se 1462046272 gbpln1086.se 1449910042 gbpln1087.se 837413052 gbpln1088.se 790648527 gbpln1089.se 626279429 gbpln109.seq 772176401 gbpln1090.se 1460620041 gbpln1091.se 1455765886 gbpln1092.se 833059054 gbpln1093.se 794545184 gbpln1094.se 774083177 gbpln1095.se 1448946753 gbpln1096.se 1458559584 gbpln1097.se 835451342 gbpln1098.se 794577233 gbpln1099.se 1329547562 gbpln11.seq 818536598 gbpln110.seq 775251446 gbpln1100.se 1454531761 gbpln1101.se 1463618989 gbpln1102.se 836809812 gbpln1103.se 806584862 gbpln1104.se 776084155 gbpln1105.se 1485075661 gbpln1106.se 1448852265 gbpln1107.se 836125457 gbpln1108.se 794049612 gbpln1109.se 744339771 gbpln111.seq 769729355 gbpln1110.se 742587081 gbpln1111.se 727014800 gbpln1112.se 1458361301 gbpln1113.se 840008504 gbpln1114.se 794029694 gbpln1115.se 769623341 gbpln1116.se 1477482614 gbpln1117.se 1456549528 gbpln1118.se 836931236 gbpln1119.se 840483636 gbpln112.seq 792455888 gbpln1120.se 768695354 gbpln1121.se 749845408 gbpln1122.se 1496378667 gbpln1123.se 659612022 gbpln1124.se 835570197 gbpln1125.se 798619346 gbpln1126.se 776375847 gbpln1127.se 751020200 gbpln1128.se 717192214 gbpln1129.se 1482268558 gbpln113.seq 803740372 gbpln1130.se 1492235450 gbpln1131.se 793920035 gbpln1132.se 773324985 gbpln1133.se 1443647684 gbpln1134.se 793436257 gbpln1135.se 665530976 gbpln1136.se 834886228 gbpln1137.se 792465315 gbpln1138.se 766375549 gbpln1139.se 1445216054 gbpln114.seq 1449349195 gbpln1140.se 1457671779 gbpln1141.se 836173230 gbpln1142.se 792990723 gbpln1143.se 774691916 gbpln1144.se 1452432506 gbpln1145.se 797342703 gbpln1146.se 1496638015 gbpln1147.se 804070482 gbpln1148.se 777569920 gbpln1149.se 372631992 gbpln115.seq 1461158646 gbpln1150.se 1466754128 gbpln1151.se 830451601 gbpln1152.se 798616435 gbpln1153.se 774880678 gbpln1154.se 1455218535 gbpln1155.se 1460523331 gbpln1156.se 837230145 gbpln1157.se 796560308 gbpln1158.se 777015504 gbpln1159.se 1467625507 gbpln116.seq 751686997 gbpln1160.se 703906948 gbpln1161.se 1455711383 gbpln1162.se 838785071 gbpln1163.se 791233293 gbpln1164.se 770014685 gbpln1165.se 1450013191 gbpln1166.se 795356170 gbpln1167.se 1495631000 gbpln1168.se 793372574 gbpln1169.se 401299113 gbpln117.seq 769401747 gbpln1170.se 1456544663 gbpln1171.se 1465313453 gbpln1172.se 839230685 gbpln1173.se 803963907 gbpln1174.se 778586682 gbpln1175.se 1463130395 gbpln1176.se 1457728697 gbpln1177.se 832496071 gbpln1178.se 797513192 gbpln1179.se 1462820325 gbpln118.seq 776551156 gbpln1180.se 1449845840 gbpln1181.se 1460493739 gbpln1182.se 839860091 gbpln1183.se 789840368 gbpln1184.se 776969912 gbpln1185.se 1450486337 gbpln1186.se 1014429015 gbpln1187.se 1476253038 gbpln1188.se 1108449375 gbpln1189.se 1144623389 gbpln119.seq 1352500221 gbpln1190.se 1271576965 gbpln1191.se 575997766 gbpln1192.se 1111693114 gbpln1193.se 480735429 gbpln1194.se 1499799432 gbpln1195.se 287261970 gbpln1196.se 903265270 gbpln1197.se 659287868 gbpln1198.se 830295693 gbpln1199.se 339200186 gbpln12.seq 1461834256 gbpln120.seq 794035728 gbpln1200.se 766241777 gbpln1201.se 750933536 gbpln1202.se 701025885 gbpln1203.se 1460262157 gbpln1204.se 800420442 gbpln1205.se 807100878 gbpln1206.se 813165275 gbpln1207.se 1489858794 gbpln1208.se 1463645427 gbpln1209.se 1282208769 gbpln121.seq 836403024 gbpln1210.se 797704105 gbpln1211.se 771673145 gbpln1212.se 1489073756 gbpln1213.se 803038467 gbpln1214.se 1494983263 gbpln1215.se 794511021 gbpln1216.se 765022116 gbpln1217.se 1450430027 gbpln1218.se 1446394679 gbpln1219.se 1487472399 gbpln122.seq 837987830 gbpln1220.se 795104781 gbpln1221.se 772053911 gbpln1222.se 744822794 gbpln1223.se 709518859 gbpln1224.se 1471789737 gbpln1225.se 159962507 gbpln1226.se 1451442059 gbpln1227.se 474894144 gbpln1228.se 820639220 gbpln1229.se 1238608963 gbpln123.seq 834487583 gbpln1230.se 1438167305 gbpln1231.se 942730875 gbpln1232.se 1413074394 gbpln1233.se 1271934713 gbpln1234.se 1485567802 gbpln1235.se 1184860474 gbpln1236.se 756169196 gbpln1237.se 1245067321 gbpln1238.se 1442415305 gbpln1239.se 1498823682 gbpln124.seq 498525119 gbpln1240.se 1480508801 gbpln1241.se 251935681 gbpln1242.se 1489873164 gbpln1243.se 669405908 gbpln1244.se 1003550591 gbpln1245.se 818534977 gbpln1246.se 744338029 gbpln1247.se 840481828 gbpln1248.se 1482265733 gbpln1249.se 450493017 gbpln125.seq 867339882 gbpln1250.se 665178568 gbpln1251.se 840478319 gbpln1252.se 804862544 gbpln1253.se 775136193 gbpln1254.se 1456887584 gbpln1255.se 1470716689 gbpln1256.se 836948259 gbpln1257.se 794972859 gbpln1258.se 775455598 gbpln1259.se 1415728346 gbpln126.seq 1463119445 gbpln1260.se 794996206 gbpln1261.se 656305255 gbpln1262.se 852997313 gbpln1263.se 798187575 gbpln1264.se 776406263 gbpln1265.se 1458385249 gbpln1266.se 1463826120 gbpln1267.se 833048862 gbpln1268.se 794071582 gbpln1269.se 488652574 gbpln127.seq 772684697 gbpln1270.se 1454827832 gbpln1271.se 793225130 gbpln1272.se 1497588685 gbpln1273.se 798464996 gbpln1274.se 775710033 gbpln1275.se 744924658 gbpln1276.se 719062576 gbpln1277.se 1455516963 gbpln1278.se 827472017 gbpln1279.se 1121159029 gbpln128.seq 799696373 gbpln1280.se 771541363 gbpln1281.se 1456098533 gbpln1282.se 1450468258 gbpln1283.se 830011447 gbpln1284.se 803324869 gbpln1285.se 778613518 gbpln1286.se 757477427 gbpln1287.se 728058413 gbpln1288.se 1460285834 gbpln1289.se 565589051 gbpln129.seq 834396522 gbpln1290.se 793156442 gbpln1291.se 771664945 gbpln1292.se 1460976066 gbpln1293.se 1472747650 gbpln1294.se 831402033 gbpln1295.se 788227480 gbpln1296.se 773608315 gbpln1297.se 756195357 gbpln1298.se 703056123 gbpln1299.se 1220877249 gbpln13.seq 1249639254 gbpln130.seq 1457115869 gbpln1300.se 833114761 gbpln1301.se 791988363 gbpln1302.se 773778680 gbpln1303.se 1439338108 gbpln1304.se 798246923 gbpln1305.se 1494014271 gbpln1306.se 790630518 gbpln1307.se 774554078 gbpln1308.se 1459431387 gbpln1309.se 920959563 gbpln131.seq 1462622889 gbpln1310.se 841885928 gbpln1311.se 814740283 gbpln1312.se 781686950 gbpln1313.se 1470777020 gbpln1314.se 817350531 gbpln1315.se 1493108072 gbpln1316.se 803943397 gbpln1317.se 776352617 gbpln1318.se 1461742228 gbpln1319.se 1225587576 gbpln132.seq 1468260082 gbpln1320.se 833628952 gbpln1321.se 800337028 gbpln1322.se 775679569 gbpln1323.se 1485372410 gbpln1324.se 1470684487 gbpln1325.se 837791026 gbpln1326.se 805450455 gbpln1327.se 782697461 gbpln1328.se 1462403294 gbpln1329.se 946518369 gbpln133.seq 810098655 gbpln1330.se 661446766 gbpln1331.se 844251896 gbpln1332.se 800661389 gbpln1333.se 770104661 gbpln1334.se 1486820730 gbpln1335.se 1437673274 gbpln1336.se 1239300617 gbpln1337.se 1472688110 gbpln1338.se 542516421 gbpln1339.se 1120694900 gbpln134.seq 1497781051 gbpln1340.se 1000301686 gbpln1341.se 1474391497 gbpln1342.se 880465505 gbpln1343.se 1479642284 gbpln1344.se 390210590 gbpln1345.se 1475783456 gbpln1346.se 386638564 gbpln1347.se 1494082682 gbpln1348.se 920369574 gbpln1349.se 1163541839 gbpln135.seq 1451245782 gbpln1350.se 432601888 gbpln1351.se 1496254118 gbpln1352.se 1375887719 gbpln1353.se 1252557046 gbpln1354.se 1083691486 gbpln1355.se 1421898882 gbpln1356.se 731360424 gbpln1357.se 2734223096 gbpln1358.se 2727931901 gbpln1359.se 650965042 gbpln136.seq 2720692598 gbpln1360.se 2732441076 gbpln1361.se 2733260927 gbpln1362.se 157556535 gbpln1363.se 2694271430 gbpln1364.se 2735442486 gbpln1365.se 2720859722 gbpln1366.se 2732011308 gbpln1367.se 2383529845 gbpln1368.se 2723191931 gbpln1369.se 1492041796 gbpln137.seq 2689474086 gbpln1370.se 2737751830 gbpln1371.se 2700210160 gbpln1372.se 2006289519 gbpln1373.se 2636141786 gbpln1374.se 2722875815 gbpln1375.se 2725415454 gbpln1376.se 2730393002 gbpln1377.se 1948886785 gbpln1378.se 2738131093 gbpln1379.se 1445294745 gbpln138.seq 2727379378 gbpln1380.se 2679871098 gbpln1381.se 2737685310 gbpln1382.se 786720890 gbpln1383.se 2727907345 gbpln1384.se 2657432129 gbpln1385.se 2735229991 gbpln1386.se 2728645371 gbpln1387.se 218791011 gbpln1388.se 2719617838 gbpln1389.se 419639997 gbpln139.seq 2721885171 gbpln1390.se 2721092581 gbpln1391.se 2679558604 gbpln1392.se 181580803 gbpln1393.se 2722179116 gbpln1394.se 2736369220 gbpln1395.se 2726783046 gbpln1396.se 2440060122 gbpln1397.se 2736724965 gbpln1398.se 2696541624 gbpln1399.se 492842184 gbpln14.seq 1427470803 gbpln140.seq 422496617 gbpln1400.se 2731302183 gbpln1401.se 2702984894 gbpln1402.se 2732485324 gbpln1403.se 1906858977 gbpln1404.se 1333776538 gbpln1405.se 366349995 gbpln1406.se 1478630796 gbpln1407.se 1339182106 gbpln1408.se 1431604314 gbpln1409.se 1155687559 gbpln141.seq 1278608219 gbpln1410.se 1257873412 gbpln1411.se 1295731353 gbpln1412.se 718233528 gbpln1413.se 1291263007 gbpln1414.se 1286241557 gbpln1415.se 1294607816 gbpln1416.se 682550439 gbpln1417.se 1244306965 gbpln1418.se 1229287067 gbpln1419.se 1457505595 gbpln142.seq 1239215741 gbpln1420.se 658635449 gbpln1421.se 1227045645 gbpln1422.se 1241387178 gbpln1423.se 568398582 gbpln1424.se 1451146676 gbpln1425.se 608730243 gbpln1426.se 1194598426 gbpln1427.se 1267961203 gbpln1428.se 1465598311 gbpln1429.se 672317516 gbpln143.seq 605904859 gbpln1430.se 1211807832 gbpln1431.se 1270318273 gbpln1432.se 1429873158 gbpln1433.se 642562848 gbpln1434.se 1201259963 gbpln1435.se 1114385426 gbpln1436.se 1428292861 gbpln1437.se 617624847 gbpln1438.se 1189205804 gbpln1439.se 1473831455 gbpln144.seq 1121198560 gbpln1440.se 691947282 gbpln1441.se 1193254570 gbpln1442.se 623008870 gbpln1443.se 1169793616 gbpln1444.se 1196787416 gbpln1445.se 1107335684 gbpln1446.se 1110445392 gbpln1447.se 1215984046 gbpln1448.se 1274875612 gbpln1449.se 390992687 gbpln145.seq 1168979121 gbpln1450.se 533030891 gbpln1451.se 1179251584 gbpln1452.se 1319824235 gbpln1453.se 1194499724 gbpln1454.se 1150884296 gbpln1455.se 1260272463 gbpln1456.se 1277796253 gbpln1457.se 1077009674 gbpln1458.se 596414735 gbpln1459.se 1444300010 gbpln146.seq 1259716685 gbpln1460.se 1082028871 gbpln1461.se 1156068258 gbpln1462.se 1092988656 gbpln1463.se 1294048234 gbpln1464.se 1076722872 gbpln1465.se 465690537 gbpln1466.se 1155398206 gbpln1467.se 700947969 gbpln1468.se 1224815553 gbpln1469.se 1464348225 gbpln147.seq 1109978919 gbpln1470.se 549436340 gbpln1471.se 1263097017 gbpln1472.se 665776881 gbpln1473.se 1235574924 gbpln1474.se 1264341710 gbpln1475.se 673868938 gbpln1476.se 1263623363 gbpln1477.se 633286407 gbpln1478.se 1197205337 gbpln1479.se 1497386714 gbpln148.seq 1237679873 gbpln1480.se 1312659113 gbpln1481.se 604892488 gbpln1482.se 1400966271 gbpln1483.se 1382372150 gbpln1484.se 1176735774 gbpln1485.se 693282470 gbpln1486.se 1202343442 gbpln1487.se 1264869868 gbpln1488.se 1017777200 gbpln1489.se 351776026 gbpln149.seq 1203792449 gbpln1490.se 1383213588 gbpln1491.se 1260660216 gbpln1492.se 1233634175 gbpln1493.se 563260621 gbpln1494.se 1296551517 gbpln1495.se 1158563945 gbpln1496.se 1059918971 gbpln1497.se 548217914 gbpln1498.se 1341167222 gbpln1499.se 1490330698 gbpln15.seq 1495030508 gbpln150.seq 1178297011 gbpln1500.se 504851755 gbpln1501.se 1193454949 gbpln1502.se 618979127 gbpln1503.se 1165155999 gbpln1504.se 1145365869 gbpln1505.se 594649456 gbpln1506.se 1136283639 gbpln1507.se 675038822 gbpln1508.se 1200907806 gbpln1509.se 746896982 gbpln151.seq 1185642826 gbpln1510.se 552386546 gbpln1511.se 1388485833 gbpln1512.se 600740349 gbpln1513.se 1103058291 gbpln1514.se 1122948167 gbpln1515.se 1380211962 gbpln1516.se 519573430 gbpln1517.se 1132007157 gbpln1518.se 1452163021 gbpln1519.se 1490380028 gbpln152.seq 1048521841 gbpln1520.se 1038155649 gbpln1521.se 833369914 gbpln1522.se 931292853 gbpln1523.se 811379776 gbpln1524.se 1077992421 gbpln1525.se 812614241 gbpln1526.se 1052276437 gbpln1527.se 1035793500 gbpln1528.se 832863065 gbpln1529.se 666076470 gbpln153.seq 922247149 gbpln1530.se 807661511 gbpln1531.se 1066166792 gbpln1532.se 997697986 gbpln1533.se 693641164 gbpln1534.se 1177445344 gbpln1535.se 1163060695 gbpln1536.se 1021882786 gbpln1537.se 1191242602 gbpln1538.se 609801478 gbpln1539.se 1394326143 gbpln154.seq 1205643923 gbpln1540.se 554031927 gbpln1541.se 1342568934 gbpln1542.se 1163523207 gbpln1543.se 500443859 gbpln1544.se 1226448377 gbpln1545.se 1349517074 gbpln1546.se 1175767295 gbpln1547.se 532052842 gbpln1548.se 1427698294 gbpln1549.se 1109798895 gbpln155.seq 239752932 gbpln1550.se 1480686507 gbpln1551.se 506996792 gbpln1552.se 1474130957 gbpln1553.se 308615956 gbpln1554.se 1480513773 gbpln1555.se 1404650425 gbpln1556.se 1478010619 gbpln1557.se 1498434279 gbpln1558.se 317320398 gbpln1559.se 1468090063 gbpln156.seq 1420113065 gbpln1560.se 627724928 gbpln1561.se 1493522663 gbpln1562.se 1483610634 gbpln1563.se 246413329 gbpln1564.se 1471156732 gbpln1565.se 1011943977 gbpln1566.se 574061324 gbpln1567.se 221798426 gbpln1568.se 1908341558 gbpln1569.se 498960662 gbpln157.seq 1899626925 gbpln1570.se 1507440270 gbpln1571.se 1195338085 gbpln1572.se 1471685919 gbpln1573.se 859088214 gbpln1574.se 1423584097 gbpln1575.se 1398057021 gbpln1576.se 1481929547 gbpln1577.se 256996209 gbpln1578.se 1487433542 gbpln1579.se 1465862621 gbpln158.seq 1109679772 gbpln1580.se 627032043 gbpln1581.se 971627123 gbpln1582.se 850272715 gbpln1583.se 849609082 gbpln1584.se 850190924 gbpln1585.se 976829654 gbpln1586.se 814643125 gbpln1587.se 879514342 gbpln1588.se 812317704 gbpln1589.se 614149015 gbpln159.seq 1488237027 gbpln1590.se 944480603 gbpln1591.se 1488070952 gbpln1592.se 187314210 gbpln1593.se 1498423603 gbpln1594.se 218416733 gbpln1595.se 1441440428 gbpln1596.se 383768559 gbpln1597.se 1224504777 gbpln1598.se 349681340 gbpln1599.se 915123308 gbpln16.seq 1465730149 gbpln160.seq 1305247057 gbpln1600.se 762473956 gbpln1601.se 1323225071 gbpln1602.se 1230459038 gbpln1603.se 1375467830 gbpln1604.se 1483298713 gbpln1605.se 525018335 gbpln1606.se 1362927202 gbpln1607.se 1281553921 gbpln1608.se 811996967 gbpln1609.se 303487869 gbpln161.seq 1463852108 gbpln1610.se 1495551316 gbpln1611.se 286829600 gbpln1612.se 1499535913 gbpln1613.se 183623567 gbpln1614.se 756041908 gbpln1615.se 1225077527 gbpln1616.se 720006493 gbpln1617.se 919172194 gbpln1618.se 874099561 gbpln1619.se 1497288212 gbpln162.seq 897784196 gbpln1620.se 876816853 gbpln1621.se 928190368 gbpln1622.se 951802003 gbpln1623.se 824940722 gbpln1624.se 1489306195 gbpln1625.se 1440059389 gbpln1626.se 1482809012 gbpln1627.se 443596730 gbpln1628.se 1400150852 gbpln1629.se 1299907776 gbpln163.seq 375114024 gbpln1630.se 1310386197 gbpln1631.se 1497352310 gbpln1632.se 236596443 gbpln1633.se 1465441436 gbpln1634.se 1028990160 gbpln1635.se 1498394092 gbpln1636.se 298447868 gbpln1637.se 1495699389 gbpln1638.se 581540409 gbpln1639.se 319271409 gbpln164.seq 1485211048 gbpln1640.se 585500235 gbpln1641.se 1497068016 gbpln1642.se 614807024 gbpln1643.se 1262770835 gbpln1644.se 813125990 gbpln1645.se 1474381949 gbpln1646.se 701582413 gbpln1647.se 1461709979 gbpln1648.se 1149761834 gbpln1649.se 1226543968 gbpln165.seq 1483546710 gbpln1650.se 930193039 gbpln1651.se 1489781091 gbpln1652.se 926396631 gbpln1653.se 1495960818 gbpln1654.se 871854711 gbpln1655.se 1473418344 gbpln1656.se 1020374305 gbpln1657.se 1424815452 gbpln1658.se 1106391649 gbpln1659.se 472201904 gbpln166.seq 1431808111 gbpln1660.se 974172538 gbpln1661.se 1488020108 gbpln167.seq 474707598 gbpln168.seq 1462560050 gbpln169.seq 346195412 gbpln17.seq 1465045969 gbpln170.seq 45376924 gbpln171.seq 1471011602 gbpln172.seq 1406572096 gbpln173.seq 1497917594 gbpln174.seq 937502730 gbpln175.seq 1471338906 gbpln176.seq 1082634808 gbpln177.seq 1466368251 gbpln178.seq 1045538877 gbpln179.seq 385021070 gbpln18.seq 1485205323 gbpln180.seq 565755694 gbpln181.seq 1455836211 gbpln182.seq 702008865 gbpln183.seq 1480976754 gbpln184.seq 464336268 gbpln185.seq 1354222615 gbpln186.seq 930875701 gbpln187.seq 1373508522 gbpln188.seq 650922585 gbpln189.seq 205693142 gbpln19.seq 1430360286 gbpln190.seq 715204913 gbpln191.seq 1486817696 gbpln192.seq 714902212 gbpln193.seq 1499652750 gbpln194.seq 1283327779 gbpln195.seq 86418 gbpln196.seq 361751 gbpln197.seq 164981114 gbpln198.seq 40089681 gbpln199.seq 980461152 gbpln2.seq 85942797 gbpln20.seq 74918158 gbpln200.seq 858166549 gbpln201.seq 1144419662 gbpln202.seq 1499995811 gbpln203.seq 291098370 gbpln204.seq 298901980 gbpln205.seq 211513289 gbpln206.seq 248674469 gbpln207.seq 1239599702 gbpln208.seq 1434095839 gbpln209.seq 1499912583 gbpln21.seq 636195341 gbpln210.seq 1474382844 gbpln211.seq 609356119 gbpln212.seq 786074578 gbpln213.seq 733167229 gbpln214.seq 1427815214 gbpln215.seq 1497769109 gbpln216.seq 785186374 gbpln217.seq 566714479 gbpln218.seq 1272845370 gbpln219.seq 300458283 gbpln22.seq 1094507719 gbpln220.seq 985319455 gbpln221.seq 921889621 gbpln222.seq 891692884 gbpln223.seq 1499996563 gbpln224.seq 73336356 gbpln225.seq 1424135934 gbpln226.seq 1500000262 gbpln227.seq 583840990 gbpln228.seq 1394280993 gbpln229.seq 1498951977 gbpln23.seq 951399156 gbpln230.seq 719212512 gbpln231.seq 981097867 gbpln232.seq 860028189 gbpln233.seq 800605872 gbpln234.seq 794469115 gbpln235.seq 1492903391 gbpln236.seq 1017587669 gbpln237.seq 924325157 gbpln238.seq 1201978654 gbpln239.seq 100249219 gbpln24.seq 1227268207 gbpln240.seq 1152253241 gbpln241.seq 1115248374 gbpln242.seq 1125506105 gbpln243.seq 1145303472 gbpln244.seq 1479141773 gbpln245.seq 324547157 gbpln246.seq 1477277107 gbpln247.seq 407347304 gbpln248.seq 117077962 gbpln249.seq 1359301073 gbpln25.seq 1328532546 gbpln250.seq 887561680 gbpln251.seq 834970472 gbpln252.seq 826391913 gbpln253.seq 792513917 gbpln254.seq 743209872 gbpln255.seq 1498927742 gbpln256.seq 860028189 gbpln257.seq 800605872 gbpln258.seq 794469115 gbpln259.seq 1435397000 gbpln26.seq 1492903391 gbpln260.seq 997390720 gbpln261.seq 663098252 gbpln262.seq 855592604 gbpln263.seq 807031053 gbpln264.seq 793905039 gbpln265.seq 1491456147 gbpln266.seq 1466632070 gbpln267.seq 840180304 gbpln268.seq 796430245 gbpln269.seq 1467916505 gbpln27.seq 779180715 gbpln270.seq 1486604510 gbpln271.seq 1445385427 gbpln272.seq 831209396 gbpln273.seq 783682955 gbpln274.seq 775938782 gbpln275.seq 1442399440 gbpln276.seq 1471877377 gbpln277.seq 872662143 gbpln278.seq 815663229 gbpln279.seq 1035036640 gbpln28.seq 813528167 gbpln280.seq 780491844 gbpln281.seq 734904793 gbpln282.seq 816941948 gbpln283.seq 1459223663 gbpln284.seq 768070182 gbpln285.seq 1491145948 gbpln286.seq 706311232 gbpln287.seq 1417708310 gbpln288.seq 830082304 gbpln289.seq 1478161497 gbpln29.seq 783385752 gbpln290.seq 770520351 gbpln291.seq 753421970 gbpln292.seq 1483888921 gbpln293.seq 702337808 gbpln294.seq 906907390 gbpln295.seq 844110716 gbpln296.seq 841780855 gbpln297.seq 805270043 gbpln298.seq 764396863 gbpln299.seq 1226308330 gbpln3.seq 718759820 gbpln30.seq 841492595 gbpln300.seq 714482811 gbpln301.seq 916127997 gbpln302.seq 858459407 gbpln303.seq 848936990 gbpln304.seq 813129213 gbpln305.seq 765593150 gbpln306.seq 862731158 gbpln307.seq 665885634 gbpln308.seq 854365265 gbpln309.seq 172902778 gbpln31.seq 802776346 gbpln310.seq 793295912 gbpln311.seq 769246240 gbpln312.seq 710912919 gbpln313.seq 1429544600 gbpln314.seq 814320946 gbpln315.seq 759349720 gbpln316.seq 762512207 gbpln317.seq 1404327068 gbpln318.seq 1468493398 gbpln319.seq 1415084627 gbpln32.seq 873292213 gbpln320.seq 827422505 gbpln321.seq 815925825 gbpln322.seq 779009585 gbpln323.seq 739747654 gbpln324.seq 1498046242 gbpln325.seq 849628701 gbpln326.seq 803882830 gbpln327.seq 794420470 gbpln328.seq 760127459 gbpln329.seq 555810468 gbpln33.seq 714663802 gbpln330.seq 1469965572 gbpln331.seq 854770002 gbpln332.seq 805931576 gbpln333.seq 798923954 gbpln334.seq 1489544894 gbpln335.seq 1467528130 gbpln336.seq 854339916 gbpln337.seq 803900400 gbpln338.seq 791449620 gbpln339.seq 1497609858 gbpln34.seq 1476207543 gbpln340.seq 1475343864 gbpln341.seq 870939392 gbpln342.seq 809408813 gbpln343.seq 801514137 gbpln344.seq 1492438448 gbpln345.seq 1476330312 gbpln346.seq 846934671 gbpln347.seq 794708793 gbpln348.seq 789781753 gbpln349.seq 695384158 gbpln35.seq 1475691254 gbpln350.seq 1489470879 gbpln351.seq 888406351 gbpln352.seq 835271741 gbpln353.seq 823533989 gbpln354.seq 787819193 gbpln355.seq 748786657 gbpln356.seq 1483648703 gbpln357.seq 283001912 gbpln358.seq 914557940 gbpln359.seq 1495430424 gbpln36.seq 898446949 gbpln360.seq 628489896 gbpln361.seq 1024113089 gbpln362.seq 1032878661 gbpln363.seq 858694781 gbpln364.seq 960391204 gbpln365.seq 1090094606 gbpln366.seq 781959143 gbpln367.seq 946995961 gbpln368.seq 857542781 gbpln369.seq 489283076 gbpln37.seq 656405285 gbpln370.seq 907889097 gbpln371.seq 896386890 gbpln372.seq 726432335 gbpln373.seq 798296822 gbpln374.seq 918393750 gbpln375.seq 584961784 gbpln376.seq 948865971 gbpln377.seq 954536271 gbpln378.seq 819735731 gbpln379.seq 1488044778 gbpln38.seq 756588093 gbpln380.seq 876067119 gbpln381.seq 625446321 gbpln382.seq 977801494 gbpln383.seq 854357980 gbpln384.seq 807732556 gbpln385.seq 947696453 gbpln386.seq 1067629605 gbpln387.seq 822222048 gbpln388.seq 950272996 gbpln389.seq 1179553878 gbpln39.seq 1488985571 gbpln390.seq 894745096 gbpln391.seq 893352134 gbpln392.seq 1498806035 gbpln393.seq 1491810166 gbpln394.seq 933986451 gbpln395.seq 939527664 gbpln396.seq 810117922 gbpln397.seq 765938558 gbpln398.seq 886537018 gbpln399.seq 769118105 gbpln4.seq 1445386724 gbpln40.seq 623519964 gbpln400.seq 996940649 gbpln401.seq 1030190034 gbpln402.seq 832828033 gbpln403.seq 956342979 gbpln404.seq 1134286144 gbpln405.seq 790513299 gbpln406.seq 944161893 gbpln407.seq 860035788 gbpln408.seq 647268685 gbpln409.seq 1421332480 gbpln41.seq 902239623 gbpln410.seq 1345936752 gbpln411.seq 787834228 gbpln412.seq 910724363 gbpln413.seq 606016896 gbpln414.seq 961485234 gbpln415.seq 1242775191 gbpln416.seq 1453328788 gbpln417.seq 818591771 gbpln418.seq 766580884 gbpln419.seq 966355920 gbpln42.seq 752100829 gbpln420.seq 1415475376 gbpln421.seq 769738288 gbpln422.seq 750738544 gbpln423.seq 1496665003 gbpln424.seq 995069022 gbpln425.seq 1012956234 gbpln426.seq 827074347 gbpln427.seq 940621783 gbpln428.seq 1079418810 gbpln429.seq 1256255782 gbpln43.seq 776922106 gbpln430.seq 938380968 gbpln431.seq 1492330319 gbpln432.seq 891714442 gbpln433.seq 878638403 gbpln434.seq 721632671 gbpln435.seq 779156122 gbpln436.seq 895553446 gbpln437.seq 604678568 gbpln438.seq 931006295 gbpln439.seq 376172115 gbpln44.seq 933660027 gbpln440.seq 810459540 gbpln441.seq 761872100 gbpln442.seq 878702815 gbpln443.seq 627081460 gbpln444.seq 994320235 gbpln445.seq 999434327 gbpln446.seq 823789349 gbpln447.seq 945629782 gbpln448.seq 1062113821 gbpln449.seq 1469659294 gbpln45.seq 792298939 gbpln450.seq 941851700 gbpln451.seq 850142413 gbpln452.seq 656955691 gbpln453.seq 904094753 gbpln454.seq 900193903 gbpln455.seq 1470079206 gbpln456.seq 1497721340 gbpln457.seq 937117048 gbpln458.seq 936021119 gbpln459.seq 320290805 gbpln46.seq 812696702 gbpln460.seq 746628212 gbpln461.seq 897168807 gbpln462.seq 626698501 gbpln463.seq 1007072101 gbpln464.seq 1000831797 gbpln465.seq 841918855 gbpln466.seq 963426816 gbpln467.seq 1093654114 gbpln468.seq 791118382 gbpln469.seq 1485324492 gbpln47.seq 959940756 gbpln470.seq 853263842 gbpln471.seq 648051398 gbpln472.seq 901282075 gbpln473.seq 923491092 gbpln474.seq 732477869 gbpln475.seq 789987733 gbpln476.seq 926022053 gbpln477.seq 610840579 gbpln478.seq 949759032 gbpln479.seq 199854535 gbpln48.seq 955444559 gbpln480.seq 818480442 gbpln481.seq 752251380 gbpln482.seq 897893149 gbpln483.seq 631111272 gbpln484.seq 1022032953 gbpln485.seq 1006306956 gbpln486.seq 837035085 gbpln487.seq 966140819 gbpln488.seq 1090560006 gbpln489.seq 1499992872 gbpln49.seq 800164754 gbpln490.seq 959884028 gbpln491.seq 886916735 gbpln492.seq 641540050 gbpln493.seq 910168783 gbpln494.seq 908785549 gbpln495.seq 729527181 gbpln496.seq 797552105 gbpln497.seq 910975470 gbpln498.seq 616026199 gbpln499.seq 1468706571 gbpln5.seq 647179239 gbpln50.seq 945685366 gbpln500.seq 953145956 gbpln501.seq 820081609 gbpln502.seq 763165947 gbpln503.seq 1489098826 gbpln504.seq 1009123187 gbpln505.seq 1016689515 gbpln506.seq 832912303 gbpln507.seq 952656374 gbpln508.seq 1065835283 gbpln509.seq 1361184932 gbpln51.seq 776075044 gbpln510.seq 935940025 gbpln511.seq 1488231655 gbpln512.seq 1487557825 gbpln513.seq 720169483 gbpln514.seq 780564861 gbpln515.seq 1499144496 gbpln516.seq 934713391 gbpln517.seq 1233388213 gbpln518.seq 807542511 gbpln519.seq 1015832925 gbpln52.seq 757881986 gbpln520.seq 889760627 gbpln521.seq 635890046 gbpln522.seq 1007873898 gbpln523.seq 1015524558 gbpln524.seq 836625022 gbpln525.seq 959076059 gbpln526.seq 1077416379 gbpln527.seq 789416089 gbpln528.seq 958430056 gbpln529.seq 1424618977 gbpln53.seq 877922843 gbpln530.seq 648665455 gbpln531.seq 907513209 gbpln532.seq 904978028 gbpln533.seq 727024880 gbpln534.seq 789120540 gbpln535.seq 898507915 gbpln536.seq 617229811 gbpln537.seq 942711764 gbpln538.seq 964780021 gbpln539.seq 833282640 gbpln54.seq 818917331 gbpln540.seq 755294557 gbpln541.seq 882064051 gbpln542.seq 627203691 gbpln543.seq 993595919 gbpln544.seq 1021497440 gbpln545.seq 827286497 gbpln546.seq 962451301 gbpln547.seq 1082256067 gbpln548.seq 781463827 gbpln549.seq 1497082726 gbpln55.seq 919665368 gbpln550.seq 1497522046 gbpln551.seq 905574854 gbpln552.seq 906714977 gbpln553.seq 718743537 gbpln554.seq 787529633 gbpln555.seq 910251919 gbpln556.seq 608518276 gbpln557.seq 934541265 gbpln558.seq 954054955 gbpln559.seq 319206973 gbpln56.seq 806443717 gbpln560.seq 1009766480 gbpln561.seq 1318260463 gbpln562.seq 1253136609 gbpln563.seq 1066198175 gbpln564.seq 1119572655 gbpln565.seq 1040217505 gbpln566.seq 1310077288 gbpln567.seq 955690374 gbpln568.seq 1230684440 gbpln569.seq 1498927430 gbpln57.seq 1179787958 gbpln570.seq 1125383520 gbpln571.seq 1051194518 gbpln572.seq 965656648 gbpln573.seq 1110314387 gbpln574.seq 907449503 gbpln575.seq 843080362 gbpln576.seq 787261705 gbpln577.seq 773098599 gbpln578.seq 1456694585 gbpln579.seq 931856203 gbpln58.seq 801494093 gbpln580.seq 1340425536 gbpln581.seq 507333599 gbpln582.seq 1445293885 gbpln583.seq 1219201533 gbpln584.seq 1281941476 gbpln585.seq 1465910871 gbpln586.seq 9838016 gbpln587.seq 1332978268 gbpln588.seq 756143249 gbpln589.seq 1495942547 gbpln59.seq 878426054 gbpln590.seq 631056251 gbpln591.seq 993852367 gbpln592.seq 1020132695 gbpln593.seq 830166807 gbpln594.seq 955723315 gbpln595.seq 1057964328 gbpln596.seq 784007552 gbpln597.seq 947940191 gbpln598.seq 857511193 gbpln599.seq 170607031 gbpln6.seq 581614185 gbpln60.seq 649137171 gbpln600.seq 903393879 gbpln601.seq 908180396 gbpln602.seq 721135945 gbpln603.seq 786739709 gbpln604.seq 918070756 gbpln605.seq 603192844 gbpln606.seq 938102555 gbpln607.seq 955978436 gbpln608.seq 1498148500 gbpln609.seq 1498805571 gbpln61.seq 423921521 gbpln610.seq 1018937144 gbpln611.seq 768159651 gbpln612.seq 891261263 gbpln613.seq 1017239134 gbpln614.seq 1036737053 gbpln615.seq 980587319 gbpln616.seq 1096962209 gbpln617.seq 964715275 gbpln618.seq 883795567 gbpln619.seq 278927988 gbpln62.seq 879409471 gbpln620.seq 922242639 gbpln621.seq 805484043 gbpln622.seq 912391541 gbpln623.seq 954577618 gbpln624.seq 974130060 gbpln625.seq 404912674 gbpln626.seq 1489898484 gbpln627.seq 1499999910 gbpln628.seq 91112872 gbpln629.seq 1456636282 gbpln63.seq 1500000091 gbpln630.seq 327590835 gbpln631.seq 1499734759 gbpln632.seq 32988398 gbpln633.seq 1499814238 gbpln634.seq 184016614 gbpln635.seq 1499903673 gbpln636.seq 1185292418 gbpln637.seq 1499990433 gbpln638.seq 413111434 gbpln639.seq 934573330 gbpln64.seq 1499995531 gbpln640.seq 602482667 gbpln641.seq 1499994875 gbpln642.seq 373411427 gbpln643.seq 1499990931 gbpln644.seq 914715139 gbpln645.seq 674055631 gbpln646.seq 865045961 gbpln647.seq 815791689 gbpln648.seq 802718902 gbpln649.seq 1473698497 gbpln65.seq 776304595 gbpln650.seq 721531499 gbpln651.seq 1489200818 gbpln652.seq 873797632 gbpln653.seq 820367220 gbpln654.seq 806296382 gbpln655.seq 775209384 gbpln656.seq 744231520 gbpln657.seq 817156402 gbpln658.seq 771380170 gbpln659.seq 405522101 gbpln66.seq 913253142 gbpln660.seq 634934982 gbpln661.seq 1019175188 gbpln662.seq 1023638564 gbpln663.seq 822225605 gbpln664.seq 961290952 gbpln665.seq 1090804562 gbpln666.seq 813694518 gbpln667.seq 962545328 gbpln668.seq 873725319 gbpln669.seq 1495859265 gbpln67.seq 673190932 gbpln670.seq 905064826 gbpln671.seq 908590682 gbpln672.seq 742712720 gbpln673.seq 793279946 gbpln674.seq 934932909 gbpln675.seq 640700840 gbpln676.seq 961568346 gbpln677.seq 952066709 gbpln678.seq 1470907411 gbpln679.seq 603645746 gbpln68.seq 1315696038 gbpln680.seq 1451561486 gbpln681.seq 1409767917 gbpln682.seq 605149309 gbpln683.seq 1109188510 gbpln684.seq 1170981868 gbpln685.seq 609718059 gbpln686.seq 1136119548 gbpln687.seq 1284507799 gbpln688.seq 1122567296 gbpln689.seq 1498515316 gbpln69.seq 1192074506 gbpln690.seq 1181896740 gbpln691.seq 692441980 gbpln692.seq 738372777 gbpln693.seq 858786663 gbpln694.seq 1482575758 gbpln695.seq 1256005171 gbpln696.seq 1249214474 gbpln697.seq 1164522681 gbpln698.seq 1002097666 gbpln699.seq 1484572601 gbpln7.seq 1308695072 gbpln70.seq 1300955592 gbpln700.seq 1317957634 gbpln701.seq 1148040939 gbpln702.seq 1403417765 gbpln703.seq 1375754075 gbpln704.seq 745221978 gbpln705.seq 1286273263 gbpln706.seq 1222805283 gbpln707.seq 738102834 gbpln708.seq 1300107704 gbpln709.seq 1356426063 gbpln71.seq 1290738490 gbpln710.seq 682607984 gbpln711.seq 777312364 gbpln712.seq 1006352199 gbpln713.seq 962815279 gbpln714.seq 975138624 gbpln715.seq 906550423 gbpln716.seq 790269619 gbpln717.seq 956926034 gbpln718.seq 908369814 gbpln719.seq 1479480118 gbpln72.seq 1035806383 gbpln720.seq 1095241384 gbpln721.seq 889046375 gbpln722.seq 920177986 gbpln723.seq 934896187 gbpln724.seq 972756494 gbpln725.seq 639243888 gbpln726.seq 839211114 gbpln727.seq 1479400215 gbpln728.seq 1382640922 gbpln729.seq 1319684527 gbpln73.seq 1372701817 gbpln730.seq 738741167 gbpln731.seq 1194847682 gbpln732.seq 449429603 gbpln733.seq 1408878447 gbpln734.seq 1491657383 gbpln735.seq 271440721 gbpln736.seq 1477932248 gbpln737.seq 1257530871 gbpln738.seq 1466995802 gbpln739.seq 451516766 gbpln74.seq 1437909873 gbpln740.seq 1307026425 gbpln741.seq 1462620068 gbpln742.seq 1087730235 gbpln743.seq 1451936168 gbpln744.seq 890586335 gbpln745.seq 628166165 gbpln746.seq 1008494769 gbpln747.seq 987228439 gbpln748.seq 843057145 gbpln749.seq 1499422292 gbpln75.seq 959088226 gbpln750.seq 1080118899 gbpln751.seq 790032688 gbpln752.seq 943744807 gbpln753.seq 858758922 gbpln754.seq 664109823 gbpln755.seq 920678547 gbpln756.seq 888501596 gbpln757.seq 739915903 gbpln758.seq 788736235 gbpln759.seq 1070174241 gbpln76.seq 944601114 gbpln760.seq 621465898 gbpln761.seq 948555730 gbpln762.seq 954911742 gbpln763.seq 854893508 gbpln764.seq 752395251 gbpln765.seq 890282441 gbpln766.seq 626588937 gbpln767.seq 1004358313 gbpln768.seq 1028945402 gbpln769.seq 1477754554 gbpln77.seq 838465030 gbpln770.seq 950517847 gbpln771.seq 1082441570 gbpln772.seq 789583361 gbpln773.seq 950035125 gbpln774.seq 853507173 gbpln775.seq 659807142 gbpln776.seq 902654821 gbpln777.seq 890952839 gbpln778.seq 721824594 gbpln779.seq 1446433546 gbpln78.seq 785634142 gbpln780.seq 909002040 gbpln781.seq 625532225 gbpln782.seq 945667284 gbpln783.seq 953425672 gbpln784.seq 871481257 gbpln785.seq 1254084023 gbpln786.seq 1125916060 gbpln787.seq 614750080 gbpln788.seq 1193223709 gbpln789.seq 1426285617 gbpln79.seq 1332440485 gbpln790.seq 808684469 gbpln791.seq 907082918 gbpln792.seq 776688264 gbpln793.seq 1492098096 gbpln794.seq 1287386861 gbpln795.seq 609236734 gbpln796.seq 1209159954 gbpln797.seq 377507568 gbpln798.seq 1484585650 gbpln799.seq 984218119 gbpln8.seq 455557137 gbpln80.seq 946681452 gbpln800.seq 950480218 gbpln801.seq 890282441 gbpln802.seq 626588937 gbpln803.seq 1004358313 gbpln804.seq 1028945402 gbpln805.seq 838465030 gbpln806.seq 950517847 gbpln807.seq 1082441570 gbpln808.seq 789583361 gbpln809.seq 1494370167 gbpln81.seq 950035125 gbpln810.seq 853507173 gbpln811.seq 659807142 gbpln812.seq 902654821 gbpln813.seq 890952839 gbpln814.seq 721824594 gbpln815.seq 785634142 gbpln816.seq 909002040 gbpln817.seq 625532225 gbpln818.seq 945667284 gbpln819.seq 1362784512 gbpln82.seq 953425672 gbpln820.seq 1496388051 gbpln821.seq 660322138 gbpln822.seq 841140962 gbpln823.seq 1479991498 gbpln824.seq 1471774772 gbpln825.seq 801426109 gbpln826.seq 1497825120 gbpln827.seq 1107189955 gbpln828.seq 1490655990 gbpln829.seq 537903618 gbpln83.seq 1128106750 gbpln830.seq 1466437965 gbpln831.seq 1161000777 gbpln832.seq 1423880580 gbpln833.seq 1214063491 gbpln834.seq 1451396326 gbpln835.seq 534355433 gbpln836.seq 1473756313 gbpln837.seq 937650337 gbpln838.seq 1409268379 gbpln839.seq 1396494473 gbpln84.seq 1413747761 gbpln840.seq 509646630 gbpln841.seq 1495475780 gbpln842.seq 527957373 gbpln843.seq 1476847011 gbpln844.seq 399440753 gbpln845.seq 1368729073 gbpln846.seq 555294430 gbpln847.seq 1450863217 gbpln848.seq 1426917875 gbpln849.seq 684881209 gbpln85.seq 310654352 gbpln850.seq 1384718199 gbpln851.seq 535518402 gbpln852.seq 1476837338 gbpln853.seq 723858950 gbpln854.seq 759028695 gbpln855.seq 898515506 gbpln856.seq 632797874 gbpln857.seq 1008257523 gbpln858.seq 1024893589 gbpln859.seq 1255396237 gbpln86.seq 849343329 gbpln860.seq 961475028 gbpln861.seq 1105697901 gbpln862.seq 806976002 gbpln863.seq 970149905 gbpln864.seq 872154954 gbpln865.seq 676154112 gbpln866.seq 905516393 gbpln867.seq 922918521 gbpln868.seq 742368603 gbpln869.seq 644937327 gbpln87.seq 788401116 gbpln870.seq 929538621 gbpln871.seq 641895628 gbpln872.seq 961976136 gbpln873.seq 973033369 gbpln874.seq 834845237 gbpln875.seq 1096228945 gbpln876.seq 1065747701 gbpln877.seq 978382753 gbpln878.seq 970377845 gbpln879.seq 1477669894 gbpln88.seq 932157797 gbpln880.seq 878151180 gbpln881.seq 874085481 gbpln882.seq 829265282 gbpln883.seq 863296712 gbpln884.seq 823515696 gbpln885.seq 815413878 gbpln886.seq 1384284611 gbpln887.seq 669344398 gbpln888.seq 1299578188 gbpln889.seq 1486392850 gbpln89.seq 613278883 gbpln890.seq 541733671 gbpln891.seq 2012725364 gbpln892.seq 2313576156 gbpln893.seq 2199353950 gbpln894.seq 2096617948 gbpln895.seq 2106642320 gbpln896.seq 1745413839 gbpln897.seq 1943630373 gbpln898.seq 43805281 gbpln899.seq 1467665665 gbpln9.seq 149356615 gbpln90.seq 1052364780 gbpln900.seq 836152673 gbpln901.seq 790234194 gbpln902.seq 768134126 gbpln903.seq 1464177021 gbpln904.seq 794343594 gbpln905.seq 1499805858 gbpln906.seq 794136795 gbpln907.seq 777214951 gbpln908.seq 750731320 gbpln909.seq 1263909550 gbpln91.seq 709232632 gbpln910.seq 1453910479 gbpln911.seq 831555004 gbpln912.seq 787385081 gbpln913.seq 774061568 gbpln914.seq 1444041489 gbpln915.seq 1462025010 gbpln916.seq 837904862 gbpln917.seq 793009108 gbpln918.seq 770582515 gbpln919.seq 753151985 gbpln92.seq 1458992600 gbpln920.seq 809917662 gbpln921.seq 662753084 gbpln922.seq 837974598 gbpln923.seq 802983165 gbpln924.seq 776399714 gbpln925.seq 749269997 gbpln926.seq 1498103845 gbpln927.seq 672385034 gbpln928.seq 841987686 gbpln929.seq 1488086519 gbpln93.seq 800255273 gbpln930.seq 776782162 gbpln931.seq 765490377 gbpln932.seq 737409430 gbpln933.seq 1467554404 gbpln934.seq 838067528 gbpln935.seq 794050154 gbpln936.seq 769006556 gbpln937.seq 1456537014 gbpln938.seq 1456423618 gbpln939.seq 1407723759 gbpln94.seq 831709069 gbpln940.seq 788018841 gbpln941.seq 776335168 gbpln942.seq 1447227789 gbpln943.seq 1462058949 gbpln944.seq 831948387 gbpln945.seq 792155197 gbpln946.seq 764395261 gbpln947.seq 1469026352 gbpln948.seq 1457035184 gbpln949.seq 1494162414 gbpln95.seq 832913530 gbpln950.seq 783381752 gbpln951.seq 777226067 gbpln952.seq 1449010172 gbpln953.seq 800066152 gbpln954.seq 659967909 gbpln955.seq 856583955 gbpln956.seq 800941651 gbpln957.seq 764839741 gbpln958.seq 1463437686 gbpln959.seq 651907412 gbpln96.seq 1457211427 gbpln960.seq 838548262 gbpln961.seq 802434968 gbpln962.seq 775426579 gbpln963.seq 752476250 gbpln964.seq 715776002 gbpln965.seq 1456996279 gbpln966.seq 836584180 gbpln967.seq 794556423 gbpln968.seq 763379902 gbpln969.seq 1490193530 gbpln97.seq 1472540375 gbpln970.seq 1467456048 gbpln971.seq 841588737 gbpln972.seq 793586133 gbpln973.seq 774193866 gbpln974.seq 1483592340 gbpln975.seq 810458179 gbpln976.seq 1487039738 gbpln977.seq 787519847 gbpln978.seq 773580778 gbpln979.seq 1492751091 gbpln98.seq 746701675 gbpln980.seq 707267127 gbpln981.seq 1458876981 gbpln982.seq 836647345 gbpln983.seq 804025438 gbpln984.seq 780287537 gbpln985.seq 1456910351 gbpln986.seq 1461116471 gbpln987.seq 847868245 gbpln988.seq 799503371 gbpln989.seq 277490570 gbpln99.seq 769858205 gbpln990.seq 1451384310 gbpln991.seq 1448178188 gbpln992.seq 841182040 gbpln993.seq 790643457 gbpln994.seq 771991395 gbpln995.seq 1449905950 gbpln996.seq 799948093 gbpln997.seq 836052022 gbpln998.seq 791807902 gbpln999.seq 148381699 gbpri1.seq 1365064130 gbpri10.seq 1336019423 gbpri11.seq 1499996596 gbpri12.seq 227230043 gbpri13.seq 1495617045 gbpri14.seq 1488562552 gbpri15.seq 1255994844 gbpri16.seq 1152821312 gbpri17.seq 1461558373 gbpri18.seq 1327599283 gbpri19.seq 1499938288 gbpri2.seq 1368003079 gbpri20.seq 1248234868 gbpri21.seq 1458591714 gbpri22.seq 1406973230 gbpri23.seq 353371961 gbpri24.seq 1457966298 gbpri25.seq 1499973379 gbpri26.seq 247223946 gbpri27.seq 1316571434 gbpri28.seq 1329314577 gbpri29.seq 892961995 gbpri3.seq 1499965390 gbpri30.seq 131268192 gbpri31.seq 1499583412 gbpri32.seq 540250595 gbpri33.seq 1484623677 gbpri34.seq 1155514979 gbpri35.seq 1499754625 gbpri4.seq 1248674023 gbpri5.seq 852828719 gbpri6.seq 162657269 gbpri7.seq 494738393 gbpri8.seq 1499996495 gbpri9.seq 752048 gbrel.txt 1499895051 gbrod1.seq 1364606089 gbrod10.seq 720172269 gbrod100.seq 1339278647 gbrod101.seq 611593151 gbrod102.seq 1419645093 gbrod103.seq 1209757347 gbrod104.seq 1441818101 gbrod105.seq 1396178967 gbrod106.seq 1351873160 gbrod107.seq 846383607 gbrod108.seq 1433880689 gbrod109.seq 967058320 gbrod11.seq 874097174 gbrod110.seq 1465720088 gbrod111.seq 771726132 gbrod112.seq 1452944377 gbrod113.seq 895279721 gbrod114.seq 1452029513 gbrod115.seq 1391575060 gbrod116.seq 254113502 gbrod117.seq 1384329105 gbrod118.seq 1452389530 gbrod119.seq 1478819696 gbrod12.seq 301613693 gbrod120.seq 1164340164 gbrod13.seq 1365976721 gbrod14.seq 782037687 gbrod15.seq 1432583977 gbrod16.seq 672937827 gbrod17.seq 1471007422 gbrod18.seq 701368584 gbrod19.seq 1079954021 gbrod2.seq 1485666339 gbrod20.seq 1039515850 gbrod21.seq 1390188394 gbrod22.seq 1351534647 gbrod23.seq 1379133925 gbrod24.seq 1090402714 gbrod25.seq 1351547492 gbrod26.seq 1434496523 gbrod27.seq 1387638765 gbrod28.seq 774513298 gbrod29.seq 1499842037 gbrod3.seq 1483025748 gbrod30.seq 1275849540 gbrod31.seq 1443775129 gbrod32.seq 1396087823 gbrod33.seq 1464212638 gbrod34.seq 1390894064 gbrod35.seq 1457113534 gbrod36.seq 1483189817 gbrod37.seq 1493035007 gbrod38.seq 1319919002 gbrod39.seq 505728660 gbrod4.seq 424097301 gbrod40.seq 1403617701 gbrod41.seq 1477924977 gbrod42.seq 199611565 gbrod43.seq 1401494568 gbrod44.seq 1388903637 gbrod45.seq 310706546 gbrod46.seq 1400027325 gbrod47.seq 1461603649 gbrod48.seq 225065456 gbrod49.seq 703742986 gbrod5.seq 1424745702 gbrod50.seq 1284962968 gbrod51.seq 469102684 gbrod52.seq 1438575392 gbrod53.seq 867442690 gbrod54.seq 1454936442 gbrod55.seq 850383541 gbrod56.seq 1281522937 gbrod57.seq 1040847553 gbrod58.seq 1451446756 gbrod59.seq 1499996287 gbrod6.seq 938452301 gbrod60.seq 1372874755 gbrod61.seq 1447005896 gbrod62.seq 185502754 gbrod63.seq 1457502126 gbrod64.seq 1386330563 gbrod65.seq 341028443 gbrod66.seq 1460394982 gbrod67.seq 732581516 gbrod68.seq 1350711034 gbrod69.seq 296690848 gbrod7.seq 1110791481 gbrod70.seq 1458676727 gbrod71.seq 822767134 gbrod72.seq 1418746662 gbrod73.seq 1300599839 gbrod74.seq 238222177 gbrod75.seq 1488562555 gbrod76.seq 883469325 gbrod77.seq 1313917093 gbrod78.seq 1160876670 gbrod79.seq 1350754791 gbrod8.seq 1439974119 gbrod80.seq 959839077 gbrod81.seq 1372051537 gbrod82.seq 1349923280 gbrod83.seq 233816573 gbrod84.seq 1371052535 gbrod85.seq 1330597820 gbrod86.seq 1444437216 gbrod87.seq 1290357211 gbrod88.seq 1392442820 gbrod89.seq 947353795 gbrod9.seq 1226020574 gbrod90.seq 1330212561 gbrod91.seq 1447730182 gbrod92.seq 1312689954 gbrod93.seq 1236107954 gbrod94.seq 1474471846 gbrod95.seq 1348543734 gbrod96.seq 1432083992 gbrod97.seq 665823558 gbrod98.seq 1411009597 gbrod99.seq 1038336576 gbsts1.seq 1456721579 gbsts2.seq 1021007768 gbsts3.seq 933647742 gbsts4.seq 1434571525 gbsyn1.seq 1499997326 gbsyn10.seq 730697061 gbsyn11.seq 529690086 gbsyn2.seq 1300574768 gbsyn3.seq 1146591620 gbsyn4.seq 1474499579 gbsyn5.seq 976985325 gbsyn6.seq 1363478755 gbsyn7.seq 1492035277 gbsyn8.seq 541839153 gbsyn9.seq 1148637248 gbtsa1.seq 284915211 gbtsa10.seq 1078282558 gbtsa11.seq 1160611678 gbtsa12.seq 1499998892 gbtsa13.seq 493076220 gbtsa14.seq 1499998876 gbtsa15.seq 229221287 gbtsa16.seq 1499999292 gbtsa17.seq 177771736 gbtsa18.seq 1356238486 gbtsa19.seq 1058521133 gbtsa2.seq 1298590575 gbtsa20.seq 1403398524 gbtsa21.seq 1499999131 gbtsa22.seq 344163063 gbtsa23.seq 1499998699 gbtsa24.seq 227020694 gbtsa25.seq 1261844914 gbtsa26.seq 964262293 gbtsa27.seq 1499995706 gbtsa28.seq 169680885 gbtsa29.seq 1275208228 gbtsa3.seq 1499998595 gbtsa30.seq 4102913 gbtsa31.seq 1131896222 gbtsa32.seq 1034997215 gbtsa33.seq 1499999757 gbtsa34.seq 548834050 gbtsa35.seq 1499999929 gbtsa36.seq 83124167 gbtsa37.seq 890368532 gbtsa38.seq 1499999968 gbtsa39.seq 1280573016 gbtsa4.seq 208341348 gbtsa40.seq 1499998117 gbtsa41.seq 231644928 gbtsa42.seq 1499995826 gbtsa43.seq 406136180 gbtsa44.seq 1499995959 gbtsa45.seq 474066476 gbtsa46.seq 1233496619 gbtsa47.seq 1499996137 gbtsa48.seq 534143574 gbtsa49.seq 1161955992 gbtsa5.seq 1500000002 gbtsa50.seq 470649008 gbtsa51.seq 1499998760 gbtsa52.seq 280311424 gbtsa53.seq 1499999355 gbtsa54.seq 423253259 gbtsa55.seq 1261020148 gbtsa6.seq 1499998007 gbtsa7.seq 72685185 gbtsa8.seq 1499998599 gbtsa9.seq 7316644 gbuna1.seq 1499972869 gbvrl1.seq 1374031896 gbvrl10.seq 1499956387 gbvrl100.seq 784230616 gbvrl101.seq 1499943782 gbvrl102.seq 774917773 gbvrl103.seq 1499996638 gbvrl104.seq 739586433 gbvrl105.seq 1499974852 gbvrl106.seq 763256824 gbvrl107.seq 1499956856 gbvrl108.seq 764467458 gbvrl109.seq 1318312705 gbvrl11.seq 1499950792 gbvrl110.seq 764064131 gbvrl111.seq 1499988184 gbvrl112.seq 137582072 gbvrl113.seq 1499958490 gbvrl114.seq 146322924 gbvrl115.seq 1499944532 gbvrl116.seq 1499969120 gbvrl117.seq 245878149 gbvrl118.seq 1499962279 gbvrl119.seq 1499999186 gbvrl12.seq 754826231 gbvrl120.seq 1499958816 gbvrl121.seq 763064638 gbvrl122.seq 1499973914 gbvrl123.seq 921483555 gbvrl124.seq 1499941348 gbvrl125.seq 167053039 gbvrl126.seq 1499941965 gbvrl127.seq 228344970 gbvrl128.seq 1499988353 gbvrl129.seq 416100239 gbvrl13.seq 309551076 gbvrl130.seq 1499991245 gbvrl131.seq 269288128 gbvrl132.seq 1499959169 gbvrl133.seq 373017560 gbvrl134.seq 1499946131 gbvrl135.seq 386450782 gbvrl136.seq 1499962479 gbvrl137.seq 525408469 gbvrl138.seq 1499997446 gbvrl139.seq 1436667659 gbvrl14.seq 270359990 gbvrl140.seq 1499980637 gbvrl141.seq 249012039 gbvrl142.seq 1499945415 gbvrl143.seq 165359318 gbvrl144.seq 1499967129 gbvrl145.seq 570784150 gbvrl146.seq 1499940482 gbvrl147.seq 464760354 gbvrl148.seq 1499998229 gbvrl149.seq 1435288207 gbvrl15.seq 502381004 gbvrl150.seq 1499994701 gbvrl151.seq 648046180 gbvrl152.seq 1499952381 gbvrl153.seq 191163816 gbvrl154.seq 1499985211 gbvrl155.seq 452085105 gbvrl156.seq 1499962656 gbvrl157.seq 223109312 gbvrl158.seq 1499987662 gbvrl159.seq 1499986292 gbvrl16.seq 361442169 gbvrl160.seq 1499937262 gbvrl161.seq 655384208 gbvrl162.seq 1499962332 gbvrl163.seq 495975290 gbvrl164.seq 1499955419 gbvrl165.seq 498051686 gbvrl166.seq 1499937105 gbvrl167.seq 278911011 gbvrl168.seq 1499958021 gbvrl169.seq 334815546 gbvrl17.seq 261340197 gbvrl170.seq 1499981182 gbvrl171.seq 239707552 gbvrl172.seq 1499967248 gbvrl173.seq 300056043 gbvrl174.seq 1499939398 gbvrl175.seq 223610739 gbvrl176.seq 1499995995 gbvrl177.seq 164214667 gbvrl178.seq 1499986849 gbvrl179.seq 1499995006 gbvrl18.seq 233364533 gbvrl180.seq 1499992495 gbvrl181.seq 459808474 gbvrl182.seq 1499976436 gbvrl183.seq 417550138 gbvrl184.seq 1499992890 gbvrl185.seq 189792762 gbvrl186.seq 1499980672 gbvrl187.seq 243814598 gbvrl188.seq 1499941610 gbvrl189.seq 301836999 gbvrl19.seq 210895978 gbvrl190.seq 1499963296 gbvrl191.seq 406126416 gbvrl192.seq 1499934513 gbvrl193.seq 298751931 gbvrl194.seq 1499985175 gbvrl195.seq 381620369 gbvrl196.seq 1499935879 gbvrl197.seq 622752384 gbvrl198.seq 1499949659 gbvrl199.seq 535797065 gbvrl2.seq 1499936982 gbvrl20.seq 215553455 gbvrl200.seq 1499978717 gbvrl201.seq 1405198099 gbvrl202.seq 1499995868 gbvrl203.seq 283709215 gbvrl204.seq 1499956347 gbvrl205.seq 167704961 gbvrl206.seq 1499979324 gbvrl207.seq 383556220 gbvrl208.seq 1499953035 gbvrl209.seq 358751916 gbvrl21.seq 777343110 gbvrl210.seq 1499989134 gbvrl211.seq 278072833 gbvrl212.seq 1499970592 gbvrl213.seq 342474845 gbvrl214.seq 1499993771 gbvrl215.seq 279422593 gbvrl216.seq 1499952368 gbvrl217.seq 288958711 gbvrl218.seq 1499952978 gbvrl219.seq 1499933574 gbvrl22.seq 457024583 gbvrl220.seq 1499960381 gbvrl221.seq 467815243 gbvrl222.seq 1499975215 gbvrl223.seq 1499938259 gbvrl224.seq 237994416 gbvrl225.seq 1499932941 gbvrl226.seq 765724077 gbvrl227.seq 1499940045 gbvrl228.seq 276311007 gbvrl229.seq 293556839 gbvrl23.seq 1499968238 gbvrl230.seq 191755804 gbvrl231.seq 1499996834 gbvrl232.seq 223767174 gbvrl233.seq 1499994776 gbvrl234.seq 236592953 gbvrl235.seq 1499935098 gbvrl236.seq 835913851 gbvrl237.seq 1499971388 gbvrl238.seq 837655478 gbvrl239.seq 1499946469 gbvrl24.seq 1499988939 gbvrl240.seq 936561372 gbvrl241.seq 1499938309 gbvrl242.seq 313999778 gbvrl243.seq 1499937379 gbvrl244.seq 352317805 gbvrl245.seq 1499973274 gbvrl246.seq 682367521 gbvrl247.seq 1499945446 gbvrl248.seq 230298392 gbvrl249.seq 698157165 gbvrl25.seq 1499936975 gbvrl250.seq 313202628 gbvrl251.seq 1499947348 gbvrl252.seq 222386425 gbvrl253.seq 1499957211 gbvrl254.seq 208397307 gbvrl255.seq 1499953889 gbvrl256.seq 170515506 gbvrl257.seq 1499978791 gbvrl258.seq 205467032 gbvrl259.seq 1499949076 gbvrl26.seq 1499920938 gbvrl260.seq 295912593 gbvrl261.seq 1499957249 gbvrl262.seq 384405916 gbvrl263.seq 1499966112 gbvrl264.seq 201609631 gbvrl265.seq 1499961204 gbvrl266.seq 411345203 gbvrl267.seq 1499942435 gbvrl268.seq 518960910 gbvrl269.seq 686814632 gbvrl27.seq 1499997615 gbvrl270.seq 187761331 gbvrl271.seq 1499996166 gbvrl272.seq 416166652 gbvrl273.seq 1499938316 gbvrl274.seq 522218047 gbvrl275.seq 1499974275 gbvrl276.seq 604774286 gbvrl277.seq 1499978033 gbvrl278.seq 142731307 gbvrl279.seq 1499997709 gbvrl28.seq 1499993210 gbvrl280.seq 211326852 gbvrl281.seq 1499934751 gbvrl282.seq 197111211 gbvrl283.seq 1499939360 gbvrl284.seq 159213285 gbvrl285.seq 1499977662 gbvrl286.seq 190018967 gbvrl287.seq 1499978964 gbvrl288.seq 651781641 gbvrl289.seq 654803096 gbvrl29.seq 492800055 gbvrl290.seq 753935354 gbvrl291.seq 76825365 gbvrl292.seq 1499968382 gbvrl293.seq 252527616 gbvrl294.seq 1499987019 gbvrl295.seq 280831626 gbvrl296.seq 1499997074 gbvrl297.seq 175476247 gbvrl298.seq 1499976226 gbvrl299.seq 1499997090 gbvrl3.seq 1499975493 gbvrl30.seq 148058589 gbvrl300.seq 1499985376 gbvrl301.seq 259854867 gbvrl302.seq 1499990215 gbvrl303.seq 141897533 gbvrl304.seq 1499995644 gbvrl305.seq 120013980 gbvrl306.seq 146315654 gbvrl307.seq 1499993952 gbvrl308.seq 126535326 gbvrl309.seq 411279220 gbvrl31.seq 1499971350 gbvrl310.seq 471575154 gbvrl311.seq 1499987042 gbvrl312.seq 148346202 gbvrl313.seq 1499967337 gbvrl314.seq 363563831 gbvrl315.seq 1499977098 gbvrl316.seq 781877443 gbvrl317.seq 1499987655 gbvrl318.seq 556571433 gbvrl319.seq 1499976625 gbvrl32.seq 1499976345 gbvrl320.seq 404383849 gbvrl321.seq 1499963477 gbvrl322.seq 358758043 gbvrl323.seq 1499966120 gbvrl324.seq 247590173 gbvrl325.seq 1499997788 gbvrl326.seq 314795368 gbvrl327.seq 1499994504 gbvrl328.seq 288183038 gbvrl329.seq 362805364 gbvrl33.seq 1499972760 gbvrl330.seq 285376689 gbvrl331.seq 1499969778 gbvrl332.seq 291838016 gbvrl333.seq 1499983232 gbvrl334.seq 289334857 gbvrl335.seq 1499991956 gbvrl336.seq 280267919 gbvrl337.seq 1499960850 gbvrl338.seq 638243646 gbvrl339.seq 1499935466 gbvrl34.seq 1499972202 gbvrl340.seq 578918054 gbvrl341.seq 1499998481 gbvrl342.seq 599138466 gbvrl343.seq 1499994978 gbvrl344.seq 118761927 gbvrl345.seq 1499999702 gbvrl346.seq 129130663 gbvrl347.seq 1499997643 gbvrl348.seq 129754504 gbvrl349.seq 326770670 gbvrl35.seq 1499987113 gbvrl350.seq 655335361 gbvrl351.seq 1499990003 gbvrl352.seq 260182883 gbvrl353.seq 1499979856 gbvrl354.seq 815755206 gbvrl355.seq 1499985185 gbvrl356.seq 400260625 gbvrl357.seq 1499985087 gbvrl358.seq 1499964474 gbvrl359.seq 1499955014 gbvrl36.seq 128304707 gbvrl360.seq 1499989406 gbvrl361.seq 1478628474 gbvrl362.seq 1499965079 gbvrl363.seq 892375602 gbvrl364.seq 1499976291 gbvrl365.seq 581292052 gbvrl366.seq 1499988415 gbvrl367.seq 1327170446 gbvrl368.seq 1499991156 gbvrl369.seq 45156819 gbvrl37.seq 868341669 gbvrl370.seq 1499965843 gbvrl371.seq 524215476 gbvrl372.seq 1499964968 gbvrl373.seq 522803565 gbvrl374.seq 1499965688 gbvrl375.seq 547042821 gbvrl376.seq 1499981956 gbvrl377.seq 511154172 gbvrl378.seq 1499965124 gbvrl379.seq 1499940966 gbvrl38.seq 243185008 gbvrl380.seq 1499984722 gbvrl381.seq 552412285 gbvrl382.seq 1499961229 gbvrl383.seq 560280642 gbvrl384.seq 1499987446 gbvrl385.seq 191450535 gbvrl386.seq 1499980989 gbvrl387.seq 187245107 gbvrl388.seq 1499992062 gbvrl389.seq 185184459 gbvrl39.seq 194261819 gbvrl390.seq 1499970778 gbvrl391.seq 224025621 gbvrl392.seq 1499984761 gbvrl393.seq 224558133 gbvrl394.seq 1499976504 gbvrl395.seq 192196591 gbvrl396.seq 1499989468 gbvrl397.seq 197533841 gbvrl398.seq 1499963161 gbvrl399.seq 817228338 gbvrl4.seq 1499982463 gbvrl40.seq 1211006043 gbvrl400.seq 1499988072 gbvrl401.seq 373548019 gbvrl402.seq 1499997878 gbvrl403.seq 117986944 gbvrl404.seq 1499997720 gbvrl405.seq 307441580 gbvrl406.seq 1499988566 gbvrl407.seq 1499988609 gbvrl408.seq 79414913 gbvrl409.seq 193684707 gbvrl41.seq 1499981020 gbvrl410.seq 286893252 gbvrl411.seq 1499994169 gbvrl412.seq 690991766 gbvrl413.seq 1499970869 gbvrl414.seq 648355058 gbvrl415.seq 1499972443 gbvrl416.seq 1002053522 gbvrl417.seq 1499998892 gbvrl418.seq 422344526 gbvrl419.seq 1499991329 gbvrl42.seq 1499993517 gbvrl420.seq 199555483 gbvrl421.seq 1499996742 gbvrl422.seq 156641592 gbvrl423.seq 1499982100 gbvrl424.seq 900553679 gbvrl425.seq 1499986807 gbvrl426.seq 845069940 gbvrl427.seq 1499960583 gbvrl428.seq 266973321 gbvrl429.seq 230283124 gbvrl43.seq 1499993266 gbvrl430.seq 155092128 gbvrl431.seq 1499967295 gbvrl432.seq 1499992263 gbvrl433.seq 111811288 gbvrl434.seq 1499996409 gbvrl435.seq 1499998216 gbvrl436.seq 110488005 gbvrl437.seq 1499974697 gbvrl438.seq 1499990602 gbvrl439.seq 1499959971 gbvrl44.seq 166973995 gbvrl440.seq 1499983908 gbvrl441.seq 834156653 gbvrl442.seq 1499993731 gbvrl443.seq 818954404 gbvrl444.seq 1499964915 gbvrl445.seq 981968618 gbvrl446.seq 1499993856 gbvrl447.seq 548472018 gbvrl448.seq 1499968322 gbvrl449.seq 202630988 gbvrl45.seq 154308129 gbvrl450.seq 1499982622 gbvrl451.seq 339429957 gbvrl452.seq 1499976116 gbvrl453.seq 275099037 gbvrl454.seq 1499999775 gbvrl455.seq 433510706 gbvrl456.seq 1499967919 gbvrl457.seq 583697439 gbvrl458.seq 1499986013 gbvrl459.seq 1499996109 gbvrl46.seq 602096993 gbvrl460.seq 1499979751 gbvrl461.seq 369501821 gbvrl462.seq 1499999388 gbvrl463.seq 660264765 gbvrl464.seq 1499992123 gbvrl465.seq 1104098075 gbvrl466.seq 1499984463 gbvrl467.seq 807624966 gbvrl468.seq 1499979791 gbvrl469.seq 252233489 gbvrl47.seq 324543448 gbvrl470.seq 1499979070 gbvrl471.seq 1178264328 gbvrl472.seq 1499966549 gbvrl473.seq 186174121 gbvrl474.seq 1499961445 gbvrl475.seq 936015222 gbvrl476.seq 1499989000 gbvrl477.seq 767653214 gbvrl478.seq 1499966991 gbvrl479.seq 1499957625 gbvrl48.seq 1099967316 gbvrl480.seq 1499989687 gbvrl481.seq 169077838 gbvrl482.seq 1499984643 gbvrl483.seq 167845153 gbvrl484.seq 1499994760 gbvrl485.seq 894202903 gbvrl486.seq 1499984151 gbvrl487.seq 393211781 gbvrl488.seq 1499934959 gbvrl489.seq 447617169 gbvrl49.seq 271496953 gbvrl490.seq 1499971341 gbvrl491.seq 140541163 gbvrl492.seq 1499948169 gbvrl493.seq 158431107 gbvrl494.seq 1499968516 gbvrl495.seq 155293767 gbvrl496.seq 1499992934 gbvrl497.seq 175272813 gbvrl498.seq 1499993120 gbvrl499.seq 1499993608 gbvrl5.seq 1499974053 gbvrl50.seq 329998573 gbvrl500.seq 147269138 gbvrl51.seq 1499983714 gbvrl52.seq 511776083 gbvrl53.seq 1499973777 gbvrl54.seq 261163675 gbvrl55.seq 1499944982 gbvrl56.seq 510777836 gbvrl57.seq 1499995174 gbvrl58.seq 817415523 gbvrl59.seq 169170507 gbvrl6.seq 1499980013 gbvrl60.seq 1230490022 gbvrl61.seq 1499971382 gbvrl62.seq 325763725 gbvrl63.seq 1499980028 gbvrl64.seq 301367589 gbvrl65.seq 1499969226 gbvrl66.seq 188123676 gbvrl67.seq 1499949587 gbvrl68.seq 763759112 gbvrl69.seq 1138254563 gbvrl7.seq 1499988754 gbvrl70.seq 240163427 gbvrl71.seq 1499956644 gbvrl72.seq 768489646 gbvrl73.seq 1499966095 gbvrl74.seq 730324025 gbvrl75.seq 1499947675 gbvrl76.seq 338621284 gbvrl77.seq 1499983032 gbvrl78.seq 135739427 gbvrl79.seq 1322695540 gbvrl8.seq 1499962296 gbvrl80.seq 154500299 gbvrl81.seq 1499961171 gbvrl82.seq 493282298 gbvrl83.seq 1499933943 gbvrl84.seq 507522902 gbvrl85.seq 1500000150 gbvrl86.seq 177157762 gbvrl87.seq 1499983292 gbvrl88.seq 768363177 gbvrl89.seq 1349996715 gbvrl9.seq 1499983227 gbvrl90.seq 782881658 gbvrl91.seq 1499989858 gbvrl92.seq 813540773 gbvrl93.seq 1499993376 gbvrl94.seq 786967571 gbvrl95.seq 1499940913 gbvrl96.seq 771088012 gbvrl97.seq 1499991668 gbvrl98.seq 784499923 gbvrl99.seq 1468058265 gbvrt1.seq 36035214 gbvrt10.seq 1485729464 gbvrt100.seq 364224646 gbvrt101.seq 1454173384 gbvrt102.seq 502254939 gbvrt103.seq 1486134171 gbvrt104.seq 517506322 gbvrt105.seq 1480727556 gbvrt106.seq 529300923 gbvrt107.seq 1459332513 gbvrt108.seq 519249086 gbvrt109.seq 18509260 gbvrt11.seq 1412269603 gbvrt110.seq 909200691 gbvrt111.seq 1459032465 gbvrt112.seq 536522478 gbvrt113.seq 1495454402 gbvrt114.seq 1299521924 gbvrt115.seq 1068402516 gbvrt116.seq 1067356333 gbvrt117.seq 896844819 gbvrt118.seq 805318347 gbvrt119.seq 1476200942 gbvrt12.seq 1275607078 gbvrt120.seq 1208361644 gbvrt121.seq 874873715 gbvrt122.seq 1313422787 gbvrt123.seq 610271897 gbvrt124.seq 1339215836 gbvrt125.seq 979774749 gbvrt126.seq 1497240842 gbvrt127.seq 618693600 gbvrt128.seq 1499998028 gbvrt129.seq 400795564 gbvrt13.seq 31406482 gbvrt130.seq 1499999976 gbvrt131.seq 315477455 gbvrt132.seq 1482267392 gbvrt133.seq 261184260 gbvrt134.seq 1499143791 gbvrt135.seq 307973844 gbvrt136.seq 1496470195 gbvrt137.seq 318409279 gbvrt138.seq 1387287611 gbvrt139.seq 1477671221 gbvrt14.seq 440417012 gbvrt140.seq 1462502954 gbvrt141.seq 397305085 gbvrt142.seq 1452249458 gbvrt143.seq 304334214 gbvrt144.seq 1499843291 gbvrt145.seq 379444472 gbvrt146.seq 1455454267 gbvrt147.seq 638926262 gbvrt148.seq 1347300249 gbvrt149.seq 1470893574 gbvrt15.seq 1090722360 gbvrt150.seq 1424049174 gbvrt151.seq 1131671891 gbvrt152.seq 1475422119 gbvrt153.seq 669038893 gbvrt154.seq 1423634438 gbvrt155.seq 610507108 gbvrt156.seq 1499738673 gbvrt157.seq 396058162 gbvrt158.seq 1465167303 gbvrt159.seq 31730937 gbvrt16.seq 1318097988 gbvrt160.seq 1411652468 gbvrt161.seq 830773125 gbvrt162.seq 1475965361 gbvrt163.seq 455697611 gbvrt164.seq 1323020998 gbvrt165.seq 551278929 gbvrt166.seq 1434907616 gbvrt167.seq 935652816 gbvrt168.seq 1471350912 gbvrt169.seq 1452402811 gbvrt17.seq 428120730 gbvrt170.seq 1491982996 gbvrt171.seq 399691693 gbvrt172.seq 1435928990 gbvrt173.seq 1247981644 gbvrt174.seq 1387198395 gbvrt175.seq 213511428 gbvrt176.seq 1489745725 gbvrt177.seq 759478599 gbvrt178.seq 1468623321 gbvrt179.seq 1092242590 gbvrt18.seq 460358961 gbvrt180.seq 1467172079 gbvrt181.seq 1345676885 gbvrt182.seq 1486880208 gbvrt183.seq 1122413695 gbvrt184.seq 1476213975 gbvrt185.seq 397154674 gbvrt186.seq 1467952250 gbvrt187.seq 389233192 gbvrt188.seq 1426124383 gbvrt189.seq 1316531590 gbvrt19.seq 405994817 gbvrt190.seq 1469721309 gbvrt191.seq 383609506 gbvrt192.seq 1381550111 gbvrt193.seq 561205445 gbvrt194.seq 1492011964 gbvrt195.seq 653049694 gbvrt196.seq 1450733084 gbvrt197.seq 1067206529 gbvrt198.seq 1459743522 gbvrt199.seq 179100385 gbvrt2.seq 499274320 gbvrt20.seq 364192132 gbvrt200.seq 1486440147 gbvrt201.seq 653832483 gbvrt202.seq 1493363852 gbvrt203.seq 916878857 gbvrt204.seq 1460465244 gbvrt205.seq 684468901 gbvrt206.seq 1448879046 gbvrt207.seq 1487906509 gbvrt208.seq 434374845 gbvrt209.seq 1481126296 gbvrt21.seq 1488705693 gbvrt210.seq 1478032480 gbvrt211.seq 278515425 gbvrt212.seq 1469979030 gbvrt213.seq 961949486 gbvrt214.seq 1483460944 gbvrt215.seq 677455821 gbvrt216.seq 1498270326 gbvrt217.seq 718453633 gbvrt218.seq 1437008966 gbvrt219.seq 940986949 gbvrt22.seq 957293922 gbvrt220.seq 1476461444 gbvrt221.seq 272371816 gbvrt222.seq 1485679392 gbvrt223.seq 1256408466 gbvrt224.seq 614199771 gbvrt225.seq 1395355507 gbvrt226.seq 696592317 gbvrt227.seq 1290299260 gbvrt228.seq 277305730 gbvrt229.seq 1487830536 gbvrt23.seq 1490466987 gbvrt230.seq 655125810 gbvrt231.seq 1446091140 gbvrt232.seq 932987741 gbvrt233.seq 1479165845 gbvrt234.seq 363696268 gbvrt235.seq 1492170807 gbvrt236.seq 923218703 gbvrt237.seq 1483460584 gbvrt238.seq 229681564 gbvrt239.seq 986318196 gbvrt24.seq 1492440393 gbvrt240.seq 1284017470 gbvrt241.seq 1394001431 gbvrt242.seq 673363046 gbvrt243.seq 1488473559 gbvrt244.seq 407893020 gbvrt245.seq 1473520932 gbvrt246.seq 654301981 gbvrt247.seq 1469440727 gbvrt248.seq 934642922 gbvrt249.seq 14152653 gbvrt25.seq 1460398956 gbvrt250.seq 1493793319 gbvrt251.seq 374388369 gbvrt252.seq 1484677935 gbvrt253.seq 1009171480 gbvrt254.seq 1403476973 gbvrt255.seq 1346978043 gbvrt256.seq 1441967866 gbvrt257.seq 1400238976 gbvrt258.seq 1431868899 gbvrt259.seq 21384662 gbvrt26.seq 1313620902 gbvrt260.seq 1468693257 gbvrt261.seq 1479203621 gbvrt262.seq 90973101 gbvrt27.seq 1499997742 gbvrt28.seq 56321478 gbvrt29.seq 1480634500 gbvrt3.seq 1460195792 gbvrt30.seq 572961549 gbvrt31.seq 621765140 gbvrt32.seq 949053871 gbvrt33.seq 529548188 gbvrt34.seq 444750187 gbvrt35.seq 889393177 gbvrt36.seq 780127735 gbvrt37.seq 1485235339 gbvrt38.seq 1479243859 gbvrt39.seq 1457482237 gbvrt4.seq 202128841 gbvrt40.seq 123737443 gbvrt41.seq 1498565199 gbvrt42.seq 763182343 gbvrt43.seq 1488184704 gbvrt44.seq 819078271 gbvrt45.seq 1499445183 gbvrt46.seq 296243230 gbvrt47.seq 1143508697 gbvrt48.seq 1296370380 gbvrt49.seq 263925679 gbvrt5.seq 746782204 gbvrt50.seq 1457234622 gbvrt51.seq 393840973 gbvrt52.seq 1494590474 gbvrt53.seq 435867530 gbvrt54.seq 1485692216 gbvrt55.seq 404627914 gbvrt56.seq 1063697372 gbvrt57.seq 1045817455 gbvrt58.seq 1371630420 gbvrt59.seq 290137511 gbvrt6.seq 960934801 gbvrt60.seq 1493316628 gbvrt61.seq 1475293258 gbvrt62.seq 58362561 gbvrt63.seq 1482158915 gbvrt64.seq 639394801 gbvrt65.seq 1498842847 gbvrt66.seq 33970348 gbvrt67.seq 979125220 gbvrt68.seq 838606763 gbvrt69.seq 87351605 gbvrt7.seq 1154852032 gbvrt70.seq 461393140 gbvrt71.seq 1435965547 gbvrt72.seq 1109806300 gbvrt73.seq 1468553589 gbvrt74.seq 102870006 gbvrt75.seq 1493447786 gbvrt76.seq 82391381 gbvrt77.seq 1481005359 gbvrt78.seq 135038714 gbvrt79.seq 784474650 gbvrt8.seq 957165421 gbvrt80.seq 366785399 gbvrt81.seq 1174207210 gbvrt82.seq 1368170987 gbvrt83.seq 1282827292 gbvrt84.seq 580591240 gbvrt85.seq 1496410569 gbvrt86.seq 1024127150 gbvrt87.seq 1427163403 gbvrt88.seq 309141780 gbvrt89.seq 15637436 gbvrt9.seq 1177165187 gbvrt90.seq 397267012 gbvrt91.seq 1323824839 gbvrt92.seq 807815425 gbvrt93.seq 1330262106 gbvrt94.seq 539530879 gbvrt95.seq 1447265202 gbvrt96.seq 467059616 gbvrt97.seq 1496966168 gbvrt98.seq 241197913 gbvrt99.seq 2.2.6 Per-Division Statistics The following table provides a per-division breakdown of the number of sequence entries and the total number of bases of DNA/RNA in each non-CON and non-WGS sequence data file. CON division records, which are constructed from other sequence records, are not represented here because their inclusion would essentially be a form of double-counting. Sequences from Whole Genome Shotgun (WGS) sequencing projects are not represented here because all WGS project data are made available on a per-project basis: ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs ftp://ftp.ncbi.nih.gov/genbank/wgs rather than being incorporated within the GenBank release distribution. Division Entries Bases BCT1 139664 536999694 BCT10 390 694003146 BCT100 313 686008328 BCT101 86 186554933 BCT102 315 673356486 BCT103 71 266229652 BCT104 359 707464119 BCT105 185 331548218 BCT106 540 723201010 BCT107 49 79557253 BCT108 259 685328142 BCT109 144 305110474 BCT11 247 282188724 BCT110 268 670236543 BCT111 114 281252692 BCT112 329 738947741 BCT113 158 230327834 BCT114 283 703675834 BCT115 77 201962351 BCT116 305 767929105 BCT117 319 584205223 BCT118 296 766696863 BCT119 59 208789717 BCT12 384 664743830 BCT120 334 692270779 BCT121 91 253364550 BCT122 288 651858869 BCT123 370 693488277 BCT124 157 354462091 BCT125 284 672223242 BCT126 97 183022758 BCT127 266 694640215 BCT128 105 213496548 BCT129 446 656193558 BCT13 316 481274184 BCT130 163 250866080 BCT131 377 706151574 BCT132 126 282249302 BCT133 327 670812957 BCT134 424 659426410 BCT135 113 172260629 BCT136 320 674859435 BCT137 189 404428216 BCT138 281 697681585 BCT139 140 403171025 BCT14 276 687623374 BCT140 369 669036164 BCT141 243 448139257 BCT142 316 699744804 BCT143 150 407349061 BCT144 478 699871534 BCT145 288 497943859 BCT146 477 746353925 BCT147 150 337823520 BCT148 959 699342382 BCT149 480 455342118 BCT15 166 297846171 BCT150 338 656362787 BCT151 545 674775711 BCT152 203 383021913 BCT153 429 667148863 BCT154 370 704497346 BCT155 57 119601929 BCT156 390 687378593 BCT157 239 472807144 BCT158 329 685145659 BCT159 199 664697068 BCT16 275 683359919 BCT160 179 240675893 BCT161 441 712261572 BCT162 289 330907991 BCT163 251 706167886 BCT164 71 284878415 BCT165 315 670872955 BCT166 428 701304051 BCT167 173 335960774 BCT168 667 730615224 BCT169 396 712058429 BCT17 301 480749119 BCT170 119 241943416 BCT171 291 674466192 BCT172 332 587815415 BCT173 319 670045139 BCT174 367 846250492 BCT175 61 146044509 BCT176 370 670602954 BCT177 369 678296218 BCT178 201 316231094 BCT179 424 675491536 BCT18 435 753272469 BCT180 311 490137761 BCT181 415 679490372 BCT182 192 437447487 BCT183 330 787716437 BCT184 187 349442111 BCT185 341 657762164 BCT186 168 445528624 BCT187 342 666061591 BCT188 163 298189685 BCT189 406 689598288 BCT19 158 290062141 BCT190 169 218145337 BCT191 472 652378164 BCT192 312 665745608 BCT193 361 692387575 BCT194 249 666682460 BCT195 80 144086040 BCT196 400 666252680 BCT197 143 254983835 BCT198 376 661814324 BCT199 315 201951674 BCT2 41290 139250707 BCT20 598 677730064 BCT200 628 644873273 BCT201 481 651195160 BCT202 70 94940965 BCT203 439 636051606 BCT204 418 612731900 BCT205 437 637962908 BCT206 220 328677699 BCT207 500 698086729 BCT208 127 251573754 BCT209 372 682660814 BCT21 139 188791496 BCT210 227 341377866 BCT211 316 688661747 BCT212 299 752239060 BCT213 68 130665359 BCT214 441 675656916 BCT215 434 667598041 BCT216 144 227879512 BCT217 334 695180798 BCT218 193 289978125 BCT219 338 660371791 BCT22 462 674392358 BCT220 260 306897426 BCT221 426 827844024 BCT222 386 727585125 BCT223 142 309990352 BCT224 304 678101365 BCT225 372 654818872 BCT226 54 66684327 BCT227 392 667048801 BCT228 470 522271952 BCT229 321 686558904 BCT23 342 372212662 BCT230 483 644375735 BCT231 75 90645632 BCT232 413 677931216 BCT233 254 367362629 BCT234 440 693114727 BCT235 350 646825420 BCT236 485 707552806 BCT237 249 529154963 BCT238 415 688842497 BCT239 210 471765803 BCT24 357 677414549 BCT240 358 671094502 BCT241 319 675028021 BCT242 46 122532076 BCT243 440 668226425 BCT244 381 644602548 BCT245 504 684756018 BCT246 335 667187177 BCT247 166 193072369 BCT248 238 646470162 BCT249 305 580249948 BCT25 294 671349427 BCT250 345 672014255 BCT251 258 420886518 BCT252 214 658347488 BCT253 232 376629222 BCT254 300 659307445 BCT255 143 216424498 BCT256 307 653479585 BCT257 180 260037147 BCT258 345 686074346 BCT259 173 296775957 BCT26 613 305747273 BCT260 377 666927692 BCT261 264 782239457 BCT262 365 747173659 BCT263 247 418943060 BCT264 437 651796745 BCT265 375 616496247 BCT266 309 667222417 BCT267 182 302230052 BCT268 438 679546578 BCT269 424 460180827 BCT27 5200 7533877 BCT270 387 699745129 BCT271 325 501491124 BCT272 416 644538422 BCT273 193 253356878 BCT274 386 691663821 BCT275 263 402417581 BCT276 443 694583877 BCT277 260 466472220 BCT278 459 693247317 BCT279 213 639323632 BCT28 10402 13141863 BCT280 292 654469081 BCT281 171 432101955 BCT282 651 649602723 BCT283 318 698634113 BCT284 175 280721442 BCT285 272 658369384 BCT286 314 485994414 BCT287 396 646216098 BCT288 176 390471586 BCT289 293 688048690 BCT29 54209 648763156 BCT290 369 671728286 BCT291 100 168361190 BCT292 333 667080044 BCT293 193 338774227 BCT294 303 664019838 BCT295 231 324037067 BCT296 344 647185266 BCT297 405 677626684 BCT298 59 98012374 BCT299 235 643472315 BCT3 20642 162919204 BCT30 121 222525681 BCT300 353 629473515 BCT301 292 640635194 BCT302 224 327193062 BCT303 405 646629552 BCT304 209 334314959 BCT305 573 674380587 BCT306 378 725714435 BCT307 6 18483781 BCT308 281 633821805 BCT309 360 654202900 BCT31 358 671327540 BCT310 147 285619086 BCT311 361 665544683 BCT312 378 627905296 BCT313 383 627347667 BCT314 266 468400974 BCT315 325 644847333 BCT316 451 673555186 BCT317 359 658952122 BCT318 424 686296793 BCT319 89 130404807 BCT32 419 594405189 BCT320 330 650007272 BCT321 105 284506479 BCT322 440 656174607 BCT323 94 265503770 BCT324 340 672439014 BCT325 206 275447558 BCT326 332 639067171 BCT327 249 499515028 BCT328 377 628733950 BCT329 215 415878255 BCT33 456 674092197 BCT330 312 678427785 BCT331 485 750363917 BCT332 4 11912114 BCT333 167 636678640 BCT334 97 631099143 BCT335 127 646036009 BCT336 57 345887642 BCT337 143 645379470 BCT338 78 433650689 BCT339 160 653226107 BCT34 372 603078315 BCT340 115 443663645 BCT341 152 648947181 BCT342 55 241628868 BCT343 121 646195308 BCT344 47 253146779 BCT345 147 647737870 BCT346 120 584084839 BCT347 134 643229316 BCT348 230 525310286 BCT349 355 705963651 BCT35 379 664089429 BCT350 183 402530142 BCT351 358 635267831 BCT352 353 525187528 BCT353 316 664994926 BCT354 226 525190349 BCT355 508 682664960 BCT356 94 269059838 BCT357 222 628005525 BCT358 135 261140776 BCT359 449 671128167 BCT36 367 677624510 BCT360 300 446674917 BCT361 473 640454650 BCT362 282 630968580 BCT363 44 49365259 BCT364 373 683809415 BCT365 279 614360383 BCT366 403 694618320 BCT367 310 518741606 BCT368 452 676362373 BCT369 125 232240613 BCT37 39 56943508 BCT370 292 654884521 BCT371 110 239102413 BCT372 386 670241512 BCT373 198 396321805 BCT374 548 676307930 BCT375 527 670975754 BCT376 192 305310552 BCT377 531 623574336 BCT378 293 611016427 BCT379 441 627143876 BCT38 374 694325818 BCT380 295 645959753 BCT381 26 104761867 BCT382 265 639847347 BCT383 379 630615010 BCT384 51 126960548 BCT385 363 628726174 BCT386 295 478775852 BCT387 262 648835144 BCT388 190 273071906 BCT389 391 632570770 BCT39 396 693357627 BCT390 262 391233747 BCT391 360 714288715 BCT392 179 585563825 BCT393 563 828720015 BCT394 408 672794166 BCT395 316 656280184 BCT396 186 370748899 BCT397 262 626371585 BCT398 405 621215565 BCT399 419 656442490 BCT4 2600 37759883 BCT40 52 118148953 BCT400 223 340394746 BCT401 333 688078851 BCT402 241 481078224 BCT403 356 669330897 BCT404 170 266451857 BCT405 265 642518397 BCT406 379 466847110 BCT407 342 655545292 BCT408 260 475834607 BCT409 358 624707174 BCT41 796 696617075 BCT410 345 605314708 BCT411 358 648866058 BCT412 255 406734626 BCT413 198 647369504 BCT414 222 618744647 BCT415 313 378730428 BCT416 378 649040273 BCT417 196 375266335 BCT418 369 617220774 BCT419 302 555938604 BCT42 230 431440059 BCT420 459 642351978 BCT421 316 679961213 BCT422 82 211624112 BCT423 452 610935467 BCT424 264 299500250 BCT425 354 625049936 BCT426 321 625554114 BCT427 15 34865413 BCT428 260 622052673 BCT429 39 243603559 BCT43 311 684059725 BCT430 188 652035629 BCT431 147 308264255 BCT432 438 648097510 BCT433 169 311815034 BCT434 195 623758807 BCT435 120 306928912 BCT436 343 622013639 BCT437 123 244628988 BCT438 392 624795532 BCT439 347 567459897 BCT44 154 357666507 BCT440 528 115589384 BCT441 1589 2511957 BCT442 3172 5268484 BCT443 6338 7796395 BCT444 12613 14997690 BCT445 25523 27672494 BCT446 50566 54072396 BCT447 166383 556300215 BCT448 12332 675554497 BCT449 37482 37185396 BCT45 144 637189325 BCT450 92237 583946925 BCT451 161671 250146338 BCT452 233740 245046478 BCT453 170493 176666222 BCT454 164080 211249352 BCT455 124079 195539297 BCT456 33016 54145060 BCT457 50525 600609271 BCT458 10328 728421317 BCT459 230 653821350 BCT46 160 545984007 BCT460 33 131631016 BCT461 1323 754705553 BCT462 315 83741870 BCT463 2127 810456341 BCT464 1183 371759925 BCT465 4193 886697155 BCT466 334 232684475 BCT467 1043 1030649457 BCT468 1955 264372364 BCT469 3187 696028611 BCT47 340 704704839 BCT470 1230 124242115 BCT471 1505 751257121 BCT472 3124 318518660 BCT473 2788 828576046 BCT474 3023 263078339 BCT475 11940 19905115 BCT476 25214 42009480 BCT477 325442 547532258 BCT478 271470 689171700 BCT479 226206 617625598 BCT48 146 405372370 BCT480 722 688004891 BCT481 577 618768312 BCT482 38 55093914 BCT483 607 618099506 BCT484 210 257204804 BCT485 792 654368007 BCT486 887 213393379 BCT487 1341 819372934 BCT488 11201 995713321 BCT489 63426 107588223 BCT49 259 690725478 BCT5 1310 133308362 BCT50 63 136095527 BCT51 279 702765807 BCT52 26 40531428 BCT53 343 697338437 BCT54 58 110998566 BCT55 301 660722517 BCT56 127 223764756 BCT57 453 673424782 BCT58 101 303664097 BCT59 242 671563340 BCT6 430 725555801 BCT60 82 227377851 BCT61 268 664367513 BCT62 56 148271596 BCT63 291 670664321 BCT64 86 227081335 BCT65 323 663992349 BCT66 333 679448001 BCT67 86 182409315 BCT68 369 662183874 BCT69 84 205444414 BCT7 316 516242823 BCT70 294 658701110 BCT71 233 500919777 BCT72 422 664297264 BCT73 223 395380525 BCT74 370 666003289 BCT75 348 636504855 BCT76 297 678329572 BCT77 343 668224512 BCT78 38 75313317 BCT79 358 673377884 BCT8 514 732280603 BCT80 94 214484227 BCT81 351 683940273 BCT82 87 223229033 BCT83 336 686119856 BCT84 103 304051498 BCT85 343 675434425 BCT86 80 115502557 BCT87 379 669168323 BCT88 88 131589933 BCT89 353 663579784 BCT9 245 283828224 BCT90 96 256891944 BCT91 356 677675082 BCT92 266 577177478 BCT93 333 670989602 BCT94 180 339695403 BCT95 366 714952072 BCT96 228 331655967 BCT97 327 660101032 BCT98 207 439418004 BCT99 293 679294620 ENV1 404937 506709341 ENV10 183059 146776383 ENV11 492910 245408708 ENV12 680883 353491833 ENV13 27923 26140362 ENV14 421694 313470755 ENV15 519063 426099006 ENV16 11751 16006918 ENV17 476491 288515159 ENV18 375200 290695381 ENV19 517433 393056635 ENV2 73 11613513 ENV20 508906 314719962 ENV21 472263 319402089 ENV22 525525 295738808 ENV23 537294 220329109 ENV24 592004 283001775 ENV25 563389 321632351 ENV26 57594 45328618 ENV27 587688 414964512 ENV28 97889 45161922 ENV29 393209 417752053 ENV3 319 731777883 ENV30 259174 548708870 ENV31 256533 729077554 ENV32 3949 384415056 ENV33 2493 1171029364 ENV34 1068 442962284 ENV35 1934 1180770225 ENV36 1128 437186186 ENV37 1768 1180613371 ENV38 21582 1111488901 ENV4 89 278074983 ENV5 284 677335420 ENV6 53756 635327021 ENV7 185739 146290752 ENV8 414918 279534879 ENV9 599249 400800118 EST1 465976 174308005 EST10 481577 252082320 EST100 158125 88082990 EST101 493158 275046361 EST102 154890 85087468 EST103 547240 296212967 EST104 168391 100328981 EST105 556373 329214741 EST106 185081 121000246 EST107 580225 336391510 EST108 545191 308142191 EST109 130519 94474032 EST11 429853 128221438 EST110 508888 301384258 EST111 109023 112354717 EST112 437565 290689053 EST113 220901 102175098 EST114 398624 285019381 EST115 130884 92539409 EST116 389716 266775573 EST117 36548 26163923 EST118 382032 252083001 EST119 161574 125946930 EST12 221159 94063393 EST120 420167 313727282 EST121 184919 116539761 EST122 462840 311430957 EST123 139788 105468049 EST124 534831 299248386 EST125 170989 73028342 EST126 571281 236570929 EST127 491989 310884819 EST128 151591 111297674 EST129 528274 304798138 EST13 574138 276186829 EST130 161308 106026732 EST131 677540 334207567 EST132 151098 28711854 EST133 559655 299741791 EST134 160224 95384731 EST135 490023 306480012 EST136 577340 193413119 EST137 188946 104628264 EST138 510403 321445357 EST139 165963 109744354 EST14 149561 63750999 EST140 414706 231859589 EST141 169139 109591947 EST142 657323 144220515 EST143 152251 98608210 EST144 534506 235415684 EST145 189664 85842442 EST146 332806 200909185 EST147 491183 305564747 EST148 155779 102526376 EST149 523254 308142252 EST15 474688 201018521 EST150 178669 59729954 EST151 587308 221970686 EST152 134728 70211808 EST153 473592 299055057 EST154 127497 99641733 EST155 459728 278586225 EST156 180967 110916687 EST157 45656 24624838 EST158 451350 303422918 EST159 183083 135579620 EST16 160842 65992054 EST160 464644 313067864 EST161 189159 129985144 EST162 407887 274749429 EST163 198569 138310610 EST164 452689 254020495 EST165 144187 103733981 EST166 425868 264733543 EST167 20620 12734823 EST168 426763 236830374 EST169 143889 94550330 EST17 306608 95571642 EST170 398052 240332689 EST171 240908 95386887 EST172 486689 279364963 EST173 138149 89269660 EST174 445456 288763289 EST175 182155 105268865 EST176 422937 273024480 EST177 103805 57906829 EST178 219943 129375172 EST179 435862 117125271 EST18 138052 41387053 EST180 190950 95121038 EST181 659096 332056302 EST182 127130 74522588 EST183 352989 223093653 EST184 493815 223270384 EST185 567683 329791022 EST186 442902 240433889 EST187 451830 310350657 EST188 381549 264729283 EST189 387238 232559712 EST19 299436 115813634 EST190 431548 239746327 EST191 424495 267800387 EST192 606518 384619438 EST193 189550 147652903 EST194 557182 367467313 EST195 188651 95531952 EST196 53496 4381716 EST197 451133 55157858 EST198 156807 31263509 EST199 460623 211506156 EST2 142972 56362966 EST20 176929 85502574 EST200 181098 124632758 EST201 445100 290099564 EST202 158052 106518489 EST203 465818 306521320 EST204 177702 52775394 EST205 457921 239013622 EST206 192739 124166988 EST207 471666 292757095 EST208 53584 36369591 EST209 419056 265466533 EST21 496958 246043309 EST210 200883 108404595 EST211 475990 286007102 EST212 152337 94448802 EST213 276286 196489423 EST214 180678 101734904 EST215 389182 240021351 EST216 198580 118458430 EST217 460276 275110831 EST218 184427 97103782 EST219 52576 18674859 EST22 154879 80580954 EST220 357770 195914248 EST221 403737 237446972 EST222 440714 284713365 EST223 154782 104219075 EST224 556630 237259583 EST225 198957 81989254 EST226 533110 305456743 EST227 172256 103855394 EST228 561980 312437493 EST229 148085 94327161 EST23 264609 135994557 EST230 601018 359923809 EST231 242717 139214337 EST232 508900 312904166 EST233 142528 105405842 EST234 476833 262183573 EST235 163063 89048145 EST236 499874 289251350 EST237 179145 110564956 EST238 483704 314410532 EST239 393878 233972777 EST24 460293 266124960 EST240 499671 220317300 EST241 576113 283373013 EST242 254793 94532453 EST25 150042 69979263 EST26 455064 225720289 EST27 144592 70134537 EST28 460797 281792175 EST29 160342 95675829 EST3 492128 195350244 EST30 484284 271250504 EST31 142359 77840949 EST32 445721 260790103 EST33 153889 89395075 EST34 29919 18235506 EST35 569214 308978499 EST36 182131 105121512 EST37 500261 278248543 EST38 139297 68362338 EST39 435073 255829231 EST4 161030 67846589 EST40 154788 96890584 EST41 589975 319712521 EST42 192052 90422854 EST43 487450 258619427 EST44 158965 76792507 EST45 9280 6073374 EST46 442741 260798718 EST47 156607 97637854 EST48 421050 306171448 EST49 138671 96437559 EST5 488671 205649453 EST50 507078 302238437 EST51 243574 145747084 EST52 601118 323929605 EST53 5247 4072427 EST54 469569 317285388 EST55 22061 15459633 EST56 250340 125936906 EST57 202081 76928243 EST58 250503 102943876 EST59 98585 38868261 EST6 150866 64812329 EST60 427303 216191888 EST61 175185 110572580 EST62 446633 263401687 EST63 190475 97972920 EST64 441422 236190066 EST65 167652 90599708 EST66 527277 302758122 EST67 102221 51075084 EST68 432405 247335621 EST69 175123 90970490 EST7 291441 131311477 EST70 543445 284379853 EST71 164437 89153404 EST72 420400 254373177 EST73 167129 91197766 EST74 355879 177143441 EST75 150529 60061844 EST76 413719 180471295 EST77 196862 91090078 EST78 311172 203722989 EST79 526471 312854441 EST8 501115 299793017 EST80 145000 99007544 EST81 433492 246106113 EST82 174266 99089757 EST83 478062 282295953 EST84 145514 81294923 EST85 459859 254721587 EST86 155832 96738108 EST87 450591 259794432 EST88 178255 102925741 EST89 5847 2580354 EST9 439351 285544455 EST90 369514 213693507 EST91 415229 292637772 EST92 419069 250971251 EST93 375416 191054939 EST94 436842 262952057 EST95 165131 96826677 EST96 439190 281516638 EST97 153002 94469004 EST98 301149 203641357 EST99 490758 268052654 GSS1 483479 349296758 GSS10 391683 194341709 GSS100 2274 1542283 GSS101 776374 133025642 GSS102 122799 38229406 GSS103 624800 195033669 GSS104 154284 118424343 GSS105 496563 436607634 GSS106 175118 110480586 GSS107 665326 198163607 GSS108 119552 74878565 GSS109 462006 285653804 GSS11 155367 79661762 GSS110 166240 155187647 GSS111 112668 95722541 GSS112 555202 399341861 GSS113 188219 120281085 GSS114 482468 298773687 GSS115 217825 157511758 GSS116 543320 316118332 GSS117 207632 160972255 GSS118 590057 423851163 GSS119 850 586793 GSS12 457196 238008904 GSS120 616159 297779103 GSS121 177796 157191723 GSS122 638931 402352079 GSS13 175144 90548059 GSS14 537019 298986355 GSS15 173003 102201943 GSS16 513089 314581178 GSS17 177549 111653998 GSS18 418012 267632244 GSS19 521973 393446021 GSS2 152811 121962910 GSS20 139684 92497595 GSS21 568921 363541416 GSS22 185578 99457730 GSS23 620985 349129033 GSS24 158242 124831479 GSS25 554090 298950468 GSS26 157711 106164335 GSS27 23373 13575160 GSS28 505039 370708561 GSS29 172261 112292009 GSS3 500646 345235457 GSS30 565436 375245186 GSS31 188389 112239236 GSS32 605466 430616003 GSS33 173702 107612445 GSS34 501724 284079029 GSS35 10996 7014618 GSS36 491030 309073818 GSS37 170755 109403665 GSS38 538043 353403523 GSS39 166078 107995492 GSS4 157003 133271684 GSS40 536737 340172826 GSS41 202632 111594409 GSS42 653734 335593144 GSS43 183488 92579192 GSS44 94686 37020965 GSS45 585911 321398749 GSS46 172776 150369921 GSS47 482732 359484724 GSS48 152735 105716923 GSS49 479141 374150005 GSS5 536920 294702650 GSS50 203415 126254195 GSS51 606791 347773427 GSS52 87651 57041080 GSS53 462295 351756795 GSS54 200794 128380249 GSS55 534833 304211555 GSS56 173044 78313504 GSS57 550605 311726285 GSS58 168220 79987296 GSS59 399167 307814698 GSS6 175736 90330569 GSS60 140506 112006346 GSS61 191812 159136714 GSS62 411776 338336075 GSS63 142406 112405669 GSS64 403234 325962624 GSS65 142862 120117095 GSS66 413177 335229827 GSS67 137857 113114394 GSS68 404638 324868198 GSS69 140643 117810168 GSS7 483637 250948919 GSS70 127182 92203837 GSS71 520909 323743563 GSS72 177517 102495279 GSS73 597632 395661030 GSS74 181036 126546097 GSS75 591119 414687777 GSS76 174298 134353538 GSS77 447818 251319701 GSS78 130317 57968536 GSS79 414776 307467555 GSS8 153561 95947803 GSS80 416891 261940117 GSS81 540328 348413356 GSS82 200211 139979325 GSS83 556164 409599797 GSS84 234505 111781688 GSS85 389319 246454652 GSS86 404418 350493972 GSS87 167924 158457537 GSS88 450647 353725576 GSS89 194833 131985347 GSS9 260253 131851340 GSS90 546343 347113850 GSS91 172839 121730031 GSS92 400359 246403089 GSS93 634003 413022963 GSS94 166388 136382073 GSS95 471133 373509240 GSS96 159807 141640417 GSS97 483856 431439713 GSS98 161900 124659678 GSS99 510919 344605321 HTC1 105590 213533747 HTC2 84852 50689748 HTC3 254863 284399082 HTC4 206260 192647591 HTG1 11398 1117560132 HTG10 4244 750053411 HTG11 5182 963529330 HTG12 5229 925700078 HTG13 5872 951465002 HTG14 5905 911954351 HTG15 5640 947566428 HTG16 5581 924865237 HTG17 5746 923702884 HTG18 5508 921042016 HTG19 5000 887751861 HTG2 5247 745343076 HTG20 5175 952063066 HTG21 7803 1147337632 HTG22 884 128257683 HTG23 8962 1119670148 HTG24 2952 336739408 HTG25 9544 1078904075 HTG26 7886 1058117822 HTG27 7154 1044981329 HTG28 6001 1063213749 HTG29 7669 1153930410 HTG3 5409 1144201139 HTG30 7331 990967405 HTG4 4824 728956388 HTG5 5091 1147003877 HTG6 3585 742321238 HTG7 5371 1144980645 HTG8 4025 736493117 HTG9 7138 1137709550 INV1 273516 651614746 INV10 2 74198017 INV100 255703 649137730 INV100 4 1094538185 INV100 224 467055727 INV100 48 1166873382 INV100 21 419145863 INV100 10 1154316587 INV100 49 1174737284 INV100 11 250196730 INV100 20 1127362232 INV100 6 591094294 INV100 39 1141924266 INV101 222476 930556764 INV101 10 392380997 INV101 36 1105816193 INV101 23 571175258 INV101 45 1121486358 INV101 17 612733718 INV101 40 1064976727 INV101 33 1183844491 INV101 3 21130809 INV101 14 1084968185 INV101 11 662670929 INV102 1014 103805595 INV102 34 1128073524 INV102 20 403806215 INV102 100 1183840214 INV102 70 225455574 INV102 42 1175039788 INV102 22 672550724 INV102 33 1114017454 INV102 27 741444754 INV102 20 1083179547 INV102 5 697761154 INV103 2061 424665927 INV103 9 1116821197 INV103 7 750167178 INV103 12 1121422029 INV103 40 1171870097 INV103 11 238542910 INV103 17 1161248546 INV103 2 191692686 INV103 19 1173452168 INV103 24 407364221 INV103 32 1139788145 INV104 1574 1167661346 INV104 5 317015352 INV104 40 1170289079 INV104 5 299724091 INV104 17 1161369887 INV104 5 495153017 INV104 6 1171254399 INV104 4 421752461 INV104 9 1160693900 INV104 6 643828914 INV104 13 1136352092 INV105 7 402809636 INV105 7 500547226 INV105 31 1165681365 INV105 24 545470219 INV105 57 1141878549 INV105 12 462839149 INV105 14 1101295629 INV105 6 557036769 INV105 12 1131940251 INV105 14 1169448537 INV105 37 1183354478 INV106 10436 1116731609 INV106 10 1182355777 INV106 5 1083758359 INV106 25 1168117365 INV106 10 181623502 INV106 47 1141906326 INV106 18 1147336069 INV106 2 162799272 INV106 51 1174106778 INV106 104 966217903 INV106 4 1071596713 INV107 251 1062752027 INV107 9 1107536877 INV107 5 517746926 INV107 23 885371414 INV107 4 1079695977 INV107 4 541647735 INV107 10 1104188691 INV107 25442 1137854245 INV107 47809 91383485 INV108 18 224818646 INV109 554 692519150 INV11 76 1113171912 INV110 62285 1082080139 INV111 58 1003563937 INV112 83 1168097044 INV113 69 1057913150 INV114 80 1184050445 INV115 77 1049714291 INV116 42 1154779406 INV117 67 1092815201 INV118 85 1182280362 INV119 38 1033117817 INV12 91 471131477 INV120 75 1168447512 INV121 66 1070706122 INV122 63 1156639442 INV123 39 1062673391 INV124 68 1171356706 INV125 24 559740797 INV126 785 1168458093 INV127 38 867568161 INV128 1919 1155913703 INV129 49794 902867470 INV13 46 1171530708 INV130 386266 249047695 INV131 363946 255814468 INV132 388713 316361870 INV133 398483 366419100 INV134 389738 423370768 INV135 5111 646124011 INV136 375072 804114761 INV137 134726 1035626041 INV138 2738 196899005 INV139 191524 1022067857 INV14 80 1150944302 INV140 20756 153351994 INV141 293970 959751037 INV142 92482 210061842 INV143 581300 685904658 INV144 51170 774722748 INV145 515288 826074612 INV146 36248 408630776 INV147 303451 944797132 INV148 175942 749886502 INV149 565831 756340788 INV15 3 198694494 INV150 157721 1044896654 INV151 71786 24058474 INV152 310460 153115693 INV153 216087 85640137 INV154 344964 222009909 INV155 18161 14795422 INV156 421377 401149956 INV157 27093 480314221 INV158 22 974588403 INV159 4 890328438 INV16 11 1112643067 INV160 6 1081490781 INV161 30 811260112 INV162 66 1177591105 INV163 848 1169005163 INV164 57 1127636884 INV165 7 619986524 INV166 907 1171565747 INV167 46 750275070 INV168 74 1181479878 INV169 51 636905406 INV17 3 372536295 INV170 43 1179274307 INV171 23 676016352 INV172 71 1180229579 INV173 41 655310157 INV174 49 1154534586 INV175 25 717723274 INV176 52 1181888300 INV177 15 748459715 INV178 39 922230747 INV179 3 790776823 INV18 15 1153719157 INV180 55 1171906377 INV181 37 646464974 INV182 43 1077704944 INV183 3 518178978 INV184 8 1160095586 INV185 12 240338361 INV186 87 1156736911 INV187 8 257485661 INV188 52 1169774643 INV189 11 221047174 INV19 3 301970333 INV190 46 1153427693 INV191 35 286756574 INV192 128 1172709580 INV193 23 388833300 INV194 354 1171116774 INV195 7 91837211 INV196 78 1180820375 INV197 50 1027942734 INV198 68 1180107650 INV199 16 971455017 INV2 47261 945904953 INV20 58 1137115496 INV200 17 1165496987 INV201 20 350566973 INV202 24 1164459467 INV203 22 376361857 INV204 45 1182545330 INV205 205 1178290897 INV206 1 24136152 INV207 44 1183135012 INV208 43 1175092098 INV209 20 1145496549 INV21 74 370878243 INV210 31 1131526231 INV211 3 207382734 INV212 31 1177639892 INV213 19 451973159 INV214 69 1173407387 INV215 111 1153874644 INV216 49 1176483557 INV217 50 889122035 INV218 20 1144896249 INV219 24 1041963359 INV22 67 1151272942 INV220 4 1063536830 INV221 36 1180705104 INV222 5 332665299 INV223 34 1160207731 INV224 14 877876842 INV225 23 1156975077 INV226 15 423920453 INV227 31 1093958113 INV228 9 519441565 INV229 7 1139607402 INV23 22 843961302 INV230 63 1109671322 INV231 1 24908900 INV232 72 1151148414 INV233 36 1083051682 INV234 1 56992732 INV235 91 1182900759 INV236 63 903773652 INV237 65 905149830 INV238 5 818528617 INV239 1 429819325 INV24 10 1140548361 INV240 40 1136402179 INV241 24 1116534048 INV242 1 170575982 INV243 9 1164226515 INV244 6 365455225 INV245 117 1090567798 INV246 17 429990184 INV247 46 1172555234 INV248 21 1143550249 INV249 1 80753270 INV25 16 1149011874 INV250 35 1175867064 INV251 26 404720046 INV252 45 1092334003 INV253 3 271412684 INV254 49 1145824106 INV255 20 289723219 INV256 58 1183115041 INV257 18 419967033 INV258 36 1147123421 INV259 8 226290514 INV26 9 105123921 INV260 16 991169918 INV261 4 406800201 INV262 48 1172507997 INV263 14 854745958 INV264 25 1137368323 INV265 29 897524208 INV266 54 1180751072 INV267 12 758994876 INV268 8 1175209336 INV269 34 332964705 INV27 84 1121876247 INV270 27 1119084587 INV271 8 496368814 INV272 16 1180264612 INV273 16 444300333 INV274 15 1056245864 INV275 1 249620899 INV276 55 1168335732 INV277 13 420235976 INV278 15 1113905915 INV279 1 283143227 INV28 2 147220534 INV280 39 1128793024 INV281 4 404991268 INV282 22 1175706978 INV283 29 264157869 INV284 43 1178393287 INV285 27 362849337 INV286 73 1175149957 INV287 18 260465922 INV288 45 1182897844 INV289 50 578151589 INV29 273 1150778041 INV290 58 1136451976 INV291 31 676305088 INV292 40 1179394077 INV293 27 588929304 INV294 18 1153312885 INV295 6 656072283 INV296 47 1116444780 INV297 6 586961391 INV298 56 1139073482 INV299 9 815123865 INV3 182 1100986300 INV30 21 329075431 INV300 34 1143915167 INV301 34 616015109 INV302 7 1087036404 INV303 2 274114667 INV304 45 1097657805 INV305 21 257681977 INV306 44 1157371711 INV307 11 223039194 INV308 37 1169310417 INV309 3 203917285 INV31 96 1147375643 INV310 50 1008179751 INV311 1 253604678 INV312 6 1093677472 INV313 75 1080810493 INV314 1 280788551 INV315 6 1053198803 INV316 27 1160643322 INV317 9 402123374 INV318 19 1171895459 INV319 41 1072590683 INV32 87 331766739 INV320 9 246954501 INV321 61 1122234529 INV322 19 1165153296 INV323 10 278909029 INV324 47 1171770266 INV325 195 1175346174 INV326 1 98076447 INV327 14 1067550412 INV328 3 344572339 INV329 40 1181305379 INV33 59 1173456559 INV330 20 563360984 INV331 7 1135518446 INV332 47 945010083 INV333 26 1180724142 INV334 1 156731404 INV335 10 1129383166 INV336 33 868693962 INV337 30 1178102174 INV338 11 463097241 INV339 58 1161408728 INV34 9 185353717 INV340 33 1128854507 INV341 7 273110839 INV342 13 1138496972 INV343 20 1142259793 INV344 7 326451249 INV345 25 1109360043 INV346 34 505527850 INV347 23 979005798 INV348 7 650668978 INV349 47 1182856260 INV35 53 1181383201 INV350 8 428612167 INV351 36 1177609778 INV352 353 327501291 INV353 91 1111219876 INV354 2 395222208 INV355 32 1139499635 INV356 14 531893343 INV357 22 1168290851 INV358 20 920703115 INV359 24 1005476694 INV36 8 161061672 INV360 24 1075280211 INV361 24 1073193819 INV362 19 887662773 INV363 1 277791574 INV364 10 1140178047 INV365 8 305088483 INV366 12 1117452242 INV367 5 475109860 INV368 15 1056280104 INV369 13 677526847 INV37 54 1166920299 INV370 60 1126302065 INV371 6 694475755 INV372 15 1149400217 INV373 75 1172827857 INV374 1 111445931 INV375 21 1162514942 INV376 100 1137918226 INV377 1 49454665 INV378 16 1023275082 INV379 9 1058545407 INV38 10 218960568 INV380 2 199741241 INV381 48 1162240956 INV382 36 917259041 INV383 44 1181158046 INV384 61 897316651 INV385 52 1066888213 INV386 10 957238398 INV387 19 1167563966 INV388 31 1015110779 INV389 14 1103227811 INV39 54 1165175634 INV390 14 775609698 INV391 23 1161823502 INV392 28 1160290406 INV393 47 1176465275 INV394 50 899789306 INV395 44 1152337180 INV396 44 1110359249 INV397 3 236174852 INV398 19 1136968481 INV399 5 501056419 INV4 4 353796308 INV40 9 190916564 INV400 29 1165109564 INV401 20 460840775 INV402 57 1136284839 INV403 6 466441095 INV404 14 686304428 INV405 1 2140038457 INV406 1 1533311695 INV407 1 991394496 INV408 1 709211797 INV409 1 559013835 INV41 53 1176815245 INV410 2 1015231349 INV411 2 680734533 INV412 5 1139385694 INV413 9 387512797 INV414 38 1149151781 INV415 7 228551836 INV416 88 1181686129 INV417 27 316005074 INV418 42 1171516152 INV419 10 185290783 INV42 9 195418297 INV420 290 1181201554 INV421 10 173472662 INV422 42 1162946064 INV423 7 197461381 INV424 68 1176382137 INV425 7 193747225 INV426 8 1122120635 INV427 6 307813224 INV428 79 1149752287 INV429 5 262281928 INV43 57 1170845875 INV430 26 1180308804 INV431 12 255298002 INV432 75 1176675281 INV433 14 248327593 INV434 53 1172445280 INV435 22 384497843 INV436 8 1166380755 INV437 29 486152035 INV438 40 1178655921 INV439 17 418976310 INV44 10 195634974 INV440 70 1182031322 INV441 18 392152070 INV442 39 1095903520 INV443 4 302073392 INV444 8 1087090309 INV445 3 367875611 INV446 41 1173135983 INV447 17 272434458 INV448 66 1172783125 INV449 10 293162809 INV45 55 1147619569 INV450 66 1176229568 INV451 1 228165927 INV452 37 1127666342 INV453 11 364644469 INV454 19 1149393244 INV455 4 99463677 INV456 11 1168395548 INV457 17 520438381 INV458 45 1171051397 INV459 29 462890848 INV46 5 243308800 INV460 26 1132569772 INV461 18 520942289 INV462 92 1172843032 INV463 15 476627646 INV464 42 1168099605 INV465 26 446630606 INV466 67 1179117010 INV467 23 469119615 INV468 83 1154955445 INV469 30 758714569 INV47 70 1009927878 INV470 39 1159304171 INV471 10 241001718 INV472 51 1176823337 INV473 34 691532969 INV474 61 1172625068 INV475 30 682406867 INV476 61 1177272705 INV477 13 684254481 INV478 10 1058561635 INV479 26 1182289903 INV48 3 813113944 INV480 11 204132428 INV481 55 1177502155 INV482 18 333480790 INV483 16 1160054366 INV484 21 460474657 INV485 48 1163269519 INV486 20 404668265 INV487 61 1172247240 INV488 28 374991644 INV489 27 1152466269 INV49 4 1008855096 INV490 4 379512269 INV491 90 1119944238 INV492 2 445736338 INV493 52 1161767093 INV494 15 431557338 INV495 32 1155774498 INV496 210 1174645524 INV497 2 26385650 INV498 88 1170537753 INV499 67 1176827893 INV5 34 1183526385 INV50 4 513393835 INV500 6 71363600 INV501 54 1165537031 INV502 19 379601315 INV503 44 1155919506 INV504 237 1056358889 INV505 2 378921420 INV506 32 1181647471 INV507 7 270001607 INV508 21 1171629453 INV509 14 461010674 INV51 38 1167088645 INV510 39 1171071737 INV511 14 342166681 INV512 55 1182543996 INV513 19 687804564 INV514 46 1163466471 INV515 44 726113674 INV516 68 1172006473 INV517 25 660741114 INV518 37 1164238669 INV519 37 767043879 INV52 144 307543456 INV520 69 1174894340 INV521 23 780407278 INV522 56 1179305319 INV523 39 1056010852 INV524 39 1170436008 INV525 349 1099604861 INV526 27 1170787413 INV527 51 1063483092 INV528 17 1097419755 INV529 5 589296853 INV53 21 1182740529 INV530 8 1109183115 INV531 2 387387157 INV532 292 1180288671 INV533 29 491164617 INV534 50 1166566430 INV535 14 349281667 INV536 18 1180940926 INV537 15 543636569 INV538 86 1160906063 INV539 22 580569362 INV54 12 635433843 INV540 54 1165239523 INV541 17 532351739 INV542 53 1162873867 INV543 28 547508741 INV544 59 1174117998 INV545 12 275890767 INV546 56 1176591424 INV547 11 282091255 INV548 37 1176450817 INV549 3 300075750 INV55 69 1175995880 INV550 17 1170398473 INV551 10 366145546 INV552 15 1183808923 INV553 29 692214430 INV554 68 1176081176 INV555 35 694701543 INV556 15 1170602412 INV557 68 1140944349 INV558 11 318389619 INV559 16 1125800549 INV56 153048 323208290 INV560 57 1181357371 INV561 11 176643969 INV562 284 1170549510 INV563 59 1163463453 INV564 49 1161552391 INV565 8 219178196 INV566 39 1176853398 INV567 5 184919638 INV568 16 1103067893 INV569 2 202273058 INV57 293975 246630288 INV570 7 1157443359 INV571 21 1168831763 INV572 1 281865375 INV573 37 1107189921 INV574 3 329372380 INV575 18 1166415167 INV576 10 401689523 INV577 55 1170958356 INV578 11 242378568 INV579 98 1169276834 INV58 39960 1040714467 INV580 13 234291481 INV581 23 1173442542 INV582 8 235471396 INV583 38 1059108018 INV584 6 313828708 INV585 64 1115037913 INV586 7 266485410 INV587 37 1173211015 INV588 14 224821814 INV589 46 1163337646 INV59 28 430019538 INV590 8 239800496 INV591 28 1169424257 INV592 56 1178676774 INV593 6 147326465 INV594 54 1163647121 INV595 28 1149969800 INV596 10 1017199002 INV597 1 210654766 INV598 7 1148462765 INV599 2 472390081 INV6 19 297443214 INV60 78 1183112976 INV600 46 1157706722 INV601 13 349630037 INV602 54 1149819012 INV603 10 355608178 INV604 58 1091215982 INV605 11 1035200436 INV606 268 1159772212 INV607 38 1113515607 INV608 1 136390895 INV609 46 1164437507 INV61 21 476524808 INV610 40 826957687 INV611 58 1179315760 INV612 6 1042444597 INV613 7 1073935065 INV614 3 433618882 INV615 40 1131808525 INV616 5 602836935 INV617 33 1172252413 INV618 11 302594749 INV619 35 1181281402 INV62 51 1168013818 INV620 73 1109484795 INV621 3 222808546 INV622 46 1175005023 INV623 13 110326208 INV624 45 1173155884 INV625 90 1180518783 INV626 2 158346272 INV627 50 1076844844 INV628 7 1132104668 INV629 2 359154098 INV63 27 491070241 INV630 10 1126653575 INV631 49 1155057985 INV632 16 1148926863 INV633 12 479432118 INV634 46 1150819712 INV635 11 309050588 INV636 66 1178761552 INV637 18 320380910 INV638 64 1179620404 INV639 25 708995082 INV64 102 1179177240 INV640 52 1182802979 INV641 20 331581745 INV642 57 1174098934 INV643 62 1073493620 INV644 40 1141758017 INV645 5 328685949 INV646 33 1174621744 INV647 30 491303488 INV648 35 1050226528 INV649 11 616512980 INV65 56 1117926882 INV650 19 1179887530 INV651 7 283887005 INV652 26 1180576662 INV653 5 576348716 INV654 11 696616259 INV655 4 1098480882 INV656 4 247410792 INV657 23 1164742126 INV658 33 804514616 INV659 30 1161344665 INV66 1 94407144 INV660 13 782319430 INV661 35 1181577893 INV662 46 723533343 INV663 22 1048373506 INV664 12 1020694987 INV665 53 1174510426 INV666 36 835900437 INV667 8 1038095140 INV668 13 1180329439 INV669 16 457486952 INV67 70 1177732067 INV670 9 1057568269 INV671 14 816084135 INV672 15 1140373678 INV673 3 399837115 INV674 24 1129639943 INV675 36 1174157392 INV676 12 148689426 INV677 20 1172698862 INV678 75 1176515731 INV679 10 113467994 INV68 221447 689503442 INV680 77 1168430039 INV681 87 1149071185 INV682 18 1128928755 INV683 22 1177260315 INV684 14 443398168 INV685 23 1115796990 INV686 13 1159346242 INV687 43 1181378857 INV688 26 707439366 INV689 30 1148523519 INV69 57903 1055436434 INV690 13 346240109 INV691 21 1105128801 INV692 12 524632913 INV693 50 1168023395 INV694 34 457025247 INV695 79 1143758856 INV696 10 506376177 INV697 55 1166742844 INV698 27 494226509 INV699 65 1165986797 INV7 74 1181961575 INV70 31 641837690 INV700 20 545455033 INV701 42 1180405673 INV702 18 421482089 INV703 29 1076309014 INV704 2 526950202 INV705 7 1014602742 INV706 3 348958771 INV707 10 1136361044 INV708 71 975019307 INV709 38 1149622989 INV71 129 1172100674 INV710 6 941961830 INV711 23 1036981527 INV712 1 195322241 INV713 46 1183891356 INV714 115 318736649 INV715 22 1176694479 INV716 4 197954523 INV717 55 1166415842 INV718 25 431770977 INV719 15 1153744291 INV72 41 759510965 INV720 18 599941963 INV721 58 1133439408 INV722 25 1172100353 INV723 4 287023245 INV724 20 1177928500 INV725 6 289987563 INV726 63 1183668969 INV727 22 871804317 INV728 10 1178565949 INV729 83 959294373 INV73 80 1177018882 INV730 84 1173318646 INV731 32 983614572 INV732 17 984681430 INV733 5 1160167511 INV734 4 968383396 INV735 5 1031138611 INV736 1 173785391 INV737 9 1175857115 INV738 12 1071919900 INV739 57 1112765851 INV74 160 732432812 INV740 3 285907573 INV741 33 1172526206 INV742 20 387866850 INV743 209 1157696720 INV744 55 951167692 INV745 51 1183206605 INV746 33 287912197 INV747 81 1166057898 INV748 5 333567415 INV749 7 1157771555 INV75 64 1183132455 INV750 2 282252146 INV751 22 1159672490 INV752 78 1146550131 INV753 34 1171027121 INV754 24 1078182774 INV755 1 141120907 INV756 31 1175918517 INV757 60 1173881038 INV758 1 38566108 INV759 32 1144571011 INV76 29 649840505 INV760 40 1101227863 INV761 2 200113839 INV762 15 1173091833 INV763 3 549536089 INV764 11 1151234513 INV765 20 643334565 INV766 66 1167559863 INV767 30 582603137 INV768 56 961445692 INV769 4 826129831 INV77 80 1180694422 INV770 7 1122891217 INV771 6 773654805 INV772 47 1167507163 INV773 37 803146093 INV774 26 1175621680 INV775 29 773698835 INV776 12 1170789341 INV777 24 399325876 INV778 21 1055389927 INV779 4 529490845 INV78 48 674849506 INV780 10 1145847553 INV781 4 385903968 INV782 14 1152569863 INV783 13 523646868 INV784 52 1140818398 INV785 8 552177835 INV786 38 1167924385 INV787 13 535556260 INV788 58 1166124907 INV789 32 610996274 INV79 70 1175199456 INV790 35 1182656851 INV791 30 815614629 INV792 1 540902015 INV793 5 1135738023 INV794 46 1175547441 INV795 9 355981500 INV796 26 1175124510 INV797 4 562554156 INV798 201 1166190476 INV799 16 620203581 INV8 37339 619526371 INV80 50 646679960 INV800 34 1125184633 INV801 9 621148114 INV802 26 1163552733 INV803 20 1135116210 INV804 5 202644379 INV805 29 1171916326 INV806 19 493858152 INV807 22 1179258290 INV808 14 680932278 INV809 9 1159699274 INV81 66 1178213441 INV810 12 964112763 INV811 40 1142294771 INV812 7 1000175726 INV813 2 506163426 INV814 37 1135047917 INV815 41 696194464 INV816 45 907408615 INV817 25 957087174 INV818 13 837980818 INV819 16 1009224553 INV82 17 214525417 INV820 53 1174974874 INV821 45 747358929 INV822 44 1159975558 INV823 11 322493981 INV824 48 1174245902 INV825 26 847474578 INV826 57 1161546715 INV827 28 859874329 INV828 56 1181449801 INV829 18 286553490 INV83 193867 816205312 INV830 29 1173501732 INV831 5 325923863 INV832 58 1179409688 INV833 27 330554813 INV834 49 1164814455 INV835 17 268867432 INV836 54 1172339728 INV837 15 828226304 INV838 22 924352601 INV839 1 268156038 INV84 29120 21131779 INV840 43 1139934415 INV841 16 466545463 INV842 24 1180888142 INV843 5 98179301 INV844 8 1166224888 INV845 29 1171022807 INV846 3 71931701 INV847 8 1056477253 INV848 2 579379686 INV849 21 1161892934 INV85 423441 304020150 INV850 50 831753780 INV851 1 530134936 INV852 7 1095668864 INV853 2 233312597 INV854 11 1131682103 INV855 36 376356686 INV856 41 1131505858 INV857 3 345957582 INV858 8 987372027 INV859 2 482999942 INV86 363150 270592454 INV860 11 1179162941 INV861 20 414948321 INV862 40 1173054389 INV863 12 254279101 INV864 30 1107116022 INV865 4 333912884 INV866 38 1164789604 INV867 49 1183261514 INV868 71 1102398920 INV869 18 1100700778 INV87 345692 259117628 INV870 1 416981589 INV871 3 1157463834 INV872 3 1060904444 INV873 2 611623168 INV874 4 1106412385 INV875 39 912374424 INV876 2 661038697 INV877 5 1137688336 INV878 16 1154482827 INV879 31 451974996 INV88 334242 216414498 INV880 21 1090976566 INV881 6 479966501 INV882 50 1089322010 INV883 4 346159624 INV884 8 1160538827 INV885 9 618678086 INV886 10 928627153 INV887 1 480241822 INV888 2 951616379 INV889 2 871667885 INV89 330476 204444184 INV890 2 818376178 INV891 2 729282197 INV892 3 961516656 INV893 18 854853893 INV894 16 890707862 INV895 2 577657875 INV896 34 1139635994 INV897 5 727905464 INV898 8 1063877851 INV899 5 590149535 INV9 129381 906404418 INV90 330020 200921246 INV900 11 1152684900 INV901 8 710744595 INV902 36 1166405653 INV903 10 625620248 INV904 19 1112325788 INV905 25 707449545 INV906 37 1002045037 INV907 8 1027154230 INV908 9 744708688 INV909 1 693712867 INV91 349261 240950261 INV910 1 690419613 INV911 1 688810701 INV912 1 639929110 INV913 1 625027500 INV914 1 623195831 INV915 1 617718696 INV916 2 1167479169 INV917 2 1124973432 INV918 2 972905134 INV919 3 915669535 INV92 446484 346833661 INV920 33 1175819391 INV921 17 337246022 INV922 35 1182263806 INV923 9 433016709 INV924 10 1134155138 INV925 17 736154490 INV926 40 1177080951 INV927 30 686206625 INV928 38 1144573634 INV929 24 1059642536 INV93 164559 278013557 INV930 12 1146055021 INV931 16 426715246 INV932 63 1164968250 INV933 19 776727519 INV934 3 1143035150 INV935 42 1134241877 INV936 13 1168959675 INV937 2 442951563 INV938 6 1166259661 INV939 4 643924932 INV94 399263 402818845 INV940 35 1175805876 INV941 9 512843503 INV942 16 1173233554 INV943 48 1172588912 INV944 7 236034213 INV945 62 1142249551 INV946 14 1124386096 INV947 15 438382888 INV948 40 1176398187 INV949 42 1147439138 INV95 38629 187147326 INV950 5 186802489 INV951 28 1113540571 INV952 25 1183920083 INV953 7 278388585 INV954 30 1179924498 INV955 6 543566409 INV956 25 1183567352 INV957 27 636126639 INV958 17 1147278217 INV959 196 610552163 INV96 800 42674647 INV960 26 1054305302 INV961 2 416648436 INV962 44 1165602779 INV963 23 537428299 INV964 31 1155380117 INV965 4 443902968 INV966 17 1181298860 INV967 15 441864740 INV968 34 1168049254 INV969 10 282815994 INV97 566 40635863 INV970 28 1140507194 INV971 17 466627605 INV972 30 1112641054 INV973 2 445716186 INV974 9 1085975686 INV975 25 642693539 INV976 30 1156609619 INV977 29 560632156 INV978 33 1051507514 INV979 2 795197424 INV98 8037 115580217 INV980 11 1170879383 INV981 41 961367314 INV982 21 1142240940 INV983 9 874060652 INV984 12 1174977387 INV985 18 860732275 INV986 19 1163517885 INV987 15 822446859 INV988 12 1137593010 INV989 15 1094577995 INV99 46584 504877383 INV990 3 480601000 INV991 51 1183760112 INV992 2 235147018 INV993 22 1165027366 INV994 26 452267105 INV995 2 940631047 INV996 2 928744483 INV997 2 883129211 INV998 3 1143834446 INV999 1 295284678 MAM1 54649 917178765 MAM10 3 308153814 MAM100 7 1147702881 MAM101 27 953979977 MAM102 5 1086466071 MAM103 12 1073178649 MAM104 1 188105751 MAM105 8 1101390325 MAM106 15 1074262986 MAM107 6 1125669670 MAM108 6 774631741 MAM109 12 1132049837 MAM11 15 1037946112 MAM110 18 1085536552 MAM111 3 320447314 MAM112 12 1178815323 MAM113 5 242278661 MAM114 47 1064535464 MAM115 3 418271949 MAM116 12 1168086867 MAM117 6 791898128 MAM118 12 1138729465 MAM119 11 658641730 MAM12 12 1137706418 MAM120 7 1170582831 MAM121 16 875048119 MAM122 7 1070781583 MAM123 12 1145013723 MAM124 4 156566841 MAM125 5 1162556979 MAM126 14 1169511893 MAM127 2 112310364 MAM128 12 1109808165 MAM129 19 1171295571 MAM13 1 103782134 MAM130 4 219237353 MAM131 8 1131294285 MAM132 8 726228234 MAM133 24 1070356570 MAM134 8 799447878 MAM135 19 1177960816 MAM136 7 731882456 MAM137 14 1164148358 MAM138 6 349193395 MAM139 12 1179433182 MAM14 19 1127022250 MAM140 4 397773065 MAM141 14 1041093991 MAM142 2 481778387 MAM143 5 1056405742 MAM144 4 577359420 MAM145 9 1094931139 MAM146 3 431583879 MAM147 9 1044771416 MAM148 3 562951973 MAM149 8 1139744895 MAM15 6 417335826 MAM150 4 450697867 MAM151 6 999063376 MAM152 3 667074377 MAM153 9 1168010004 MAM154 4 606841363 MAM155 19 1183539355 MAM156 6 784240423 MAM157 11 1178122221 MAM158 9 737268083 MAM159 8 1101462276 MAM16 20 1114156407 MAM160 10516 1093379399 MAM17 8 440415269 MAM18 18 1173305826 MAM19 5 246617504 MAM2 2 376685399 MAM20 16 1178104214 MAM21 10 836799539 MAM22 10 1171820346 MAM23 12 1029020087 MAM24 9 26809642 MAM25 54 7614329 MAM26 215 34073042 MAM27 431 71272130 MAM28 861 68509101 MAM29 1706 2411269 MAM3 9 1159833615 MAM30 6879 6176592 MAM31 110526 193403794 MAM32 33201 1099561407 MAM33 16 932399762 MAM34 253373 712937465 MAM35 6052 721714412 MAM36 1 662751787 MAM37 1 611347268 MAM38 5 1091124403 MAM39 4 833121924 MAM4 936 397469053 MAM40 9 1173688690 MAM41 370 631762200 MAM42 11 1148682982 MAM43 265 655228071 MAM44 14 1129485591 MAM45 10 780461055 MAM46 12 1154949216 MAM47 11 821210834 MAM48 3346 1174847022 MAM49 207460 650756767 MAM5 26814 24994146 MAM50 14 1092077466 MAM51 14 1163101092 MAM52 279 336844158 MAM53 6 1088563449 MAM54 11 1170209443 MAM55 4 257416099 MAM56 396 1126820426 MAM57 11 1123823459 MAM58 28 322280472 MAM59 9 1118303675 MAM6 13731 20581276 MAM60 15 1166025468 MAM61 6 401152657 MAM62 8 1076435216 MAM63 2 226942227 MAM64 14 1132032412 MAM65 271 307742124 MAM66 6 1084909688 MAM67 5 579063099 MAM68 13 1159289868 MAM69 2 319966445 MAM7 3445 7368868 MAM70 10 1125919330 MAM71 9 578892446 MAM72 11 1080315572 MAM73 11 752575683 MAM74 17 1117115584 MAM75 5 616253053 MAM76 10 1124329418 MAM77 2 272528628 MAM78 8 1171546937 MAM79 3 311079698 MAM8 107 699953 MAM80 19 1111022050 MAM81 1 178365832 MAM82 9 1137930415 MAM83 4 370992980 MAM84 12 1061089740 MAM85 2 296330659 MAM86 10 1109747736 MAM87 3 260392119 MAM88 10 1145323782 MAM89 2 211903297 MAM9 24 978923755 MAM90 10 1116587684 MAM91 8 367669076 MAM92 12 1121894092 MAM93 6 418702010 MAM94 16 1015883955 MAM95 4 651631450 MAM96 11 1156896317 MAM97 10 658511106 MAM98 11 1138344427 MAM99 165 648612555 PAT1 799937 380650087 PAT10 271895 194870018 PAT100 855295 50272813 PAT101 96566 20012584 PAT102 893771 125915996 PAT103 790992 623139960 PAT104 565823 806468807 PAT105 779693 427337725 PAT106 815031 321652669 PAT107 713904 246145656 PAT108 728138 463603491 PAT109 81360 153141874 PAT11 695316 537302870 PAT12 616745 312423158 PAT13 550435 336234424 PAT14 558843 479644330 PAT15 97886 9820533 PAT16 618968 522600188 PAT17 98835 382939732 PAT18 797353 222348363 PAT19 31169 33403273 PAT2 809085 544871876 PAT20 804549 303117744 PAT21 92452 1756588 PAT22 846018 25272339 PAT23 846018 16403244 PAT24 936830 589670636 PAT25 707138 139681125 PAT26 754654 539398031 PAT27 1095352 307304135 PAT28 610387 236245640 PAT29 520675 733807170 PAT3 625018 303686612 PAT30 630876 626582223 PAT31 725834 389970554 PAT32 725834 350765074 PAT33 808618 106711475 PAT34 614454 198519627 PAT35 706860 516370760 PAT36 161612 40887238 PAT37 1047866 19909454 PAT38 720643 78270616 PAT39 685448 388769770 PAT4 623619 423631098 PAT40 776835 341284579 PAT41 925604 622455932 PAT42 130468 96635421 PAT43 836770 697037292 PAT44 219302 91982645 PAT45 478398 369730555 PAT46 465573 363885306 PAT47 538688 501452614 PAT48 1460 4603802 PAT49 478541 109414935 PAT5 635000 361815202 PAT50 275396 358965751 PAT51 229252 116776485 PAT52 504649 200780045 PAT53 688229 330989793 PAT54 517739 781723621 PAT55 696501 289726628 PAT56 696501 196685805 PAT57 1175480 45090107 PAT58 623122 230103271 PAT59 455428 838741066 PAT6 633134 411695605 PAT60 455428 365884940 PAT61 325231 482206711 PAT62 121982 154449698 PAT63 447213 131724501 PAT64 1032880 196383084 PAT65 227776 118142255 PAT66 802491 187547556 PAT67 737903 168772635 PAT68 65066 7149938 PAT69 300935 428633458 PAT7 751933 290751828 PAT70 312425 86908455 PAT71 661716 354757423 PAT72 105682 68107937 PAT73 635968 172920997 PAT74 7666 114990 PAT75 600007 253224862 PAT76 22948 34610499 PAT77 387425 636579263 PAT78 6530 8858406 PAT79 482747 437258120 PAT8 146945 94866926 PAT80 309974 73656116 PAT81 671488 154795553 PAT82 246651 90238277 PAT83 234680 377596743 PAT84 208570 85618763 PAT85 1025193 21516964 PAT86 331154 110021550 PAT87 743946 592297584 PAT88 601967 722579971 PAT89 572273 786734443 PAT9 704058 375636088 PAT90 620176 688425199 PAT91 790293 652398383 PAT92 304116 76037464 PAT93 512789 752893376 PAT94 826524 599374610 PAT95 643350 725078440 PAT96 629482 818364735 PAT97 381127 520363322 PAT98 701251 321706921 PAT99 558444 41542612 PHG1 18937 659338801 PHG2 16336 686754141 PHG3 10594 182275861 PLN1 182369 828375546 PLN10 158 829520559 PLN100 35 1162360688 PLN100 1 608830648 PLN100 2 1146797356 PLN100 2 1146984767 PLN100 1 526310788 PLN100 1 664689228 PLN100 1 632403820 PLN100 1 613638454 PLN100 2 1172960765 PLN100 2 1147017396 PLN100 1 660476038 PLN101 73 724972614 PLN101 1 624334204 PLN101 1 613769411 PLN101 1 589927450 PLN101 1 557572468 PLN101 2 1148490360 PLN101 1 663019822 PLN101 1 626669531 PLN101 1 612901747 PLN101 2 1150057662 PLN101 2 1157797487 PLN102 45 1142219311 PLN102 1 667210568 PLN102 1 635382001 PLN102 1 614569426 PLN102 2 1169192410 PLN102 2 1163716432 PLN102 1 626973123 PLN102 1 611284754 PLN102 2 1150481064 PLN102 1 659290088 PLN102 2 1150737255 PLN103 10 661759416 PLN103 1 660553991 PLN103 1 632999331 PLN103 1 616334843 PLN103 1 595538521 PLN103 1 579057524 PLN103 2 1159220941 PLN103 1 659217363 PLN103 1 627225202 PLN103 1 611858135 PLN103 2 1164391514 PLN104 72 1160482328 PLN104 2 1152376894 PLN104 1 660591081 PLN104 1 627080904 PLN104 1 609113147 PLN104 2 1138662036 PLN104 1 628475395 PLN104 1 525655293 PLN104 1 659787933 PLN104 1 626680366 PLN104 1 612118009 PLN105 8 360700132 PLN105 1 587712295 PLN105 1 559096804 PLN105 2 1153763781 PLN105 1 662624081 PLN105 1 626502968 PLN105 1 614857888 PLN105 2 1161694293 PLN105 2 1153142705 PLN105 1 669220190 PLN105 1 629226312 PLN106 43 1155810616 PLN106 1 613110551 PLN106 2 1144904879 PLN106 2 1160236768 PLN106 1 658438119 PLN106 1 628047470 PLN106 1 612916554 PLN106 2 1143852611 PLN106 2 1150763450 PLN106 1 657631428 PLN106 1 629616096 PLN107 53 752164064 PLN107 1 610488678 PLN107 2 1145704528 PLN107 2 1148031132 PLN107 1 655385637 PLN107 1 626286153 PLN107 1 610690180 PLN107 2 1141737084 PLN107 2 1145450335 PLN107 1 659936173 PLN107 1 627661034 PLN108 158 1145539918 PLN108 1 608478632 PLN108 2 1164887918 PLN108 2 1157801119 PLN108 1 654540277 PLN108 1 624453744 PLN108 1 610565479 PLN108 2 1154225896 PLN108 2 1144646810 PLN108 1 661109612 PLN108 1 624188817 PLN109 1 494422770 PLN109 1 609603980 PLN109 2 1153106963 PLN109 2 1149274143 PLN109 1 657668641 PLN109 1 627263816 PLN109 1 611107145 PLN109 2 1143888586 PLN109 2 1151475536 PLN109 1 659552134 PLN109 1 627284235 PLN11 4 1049626460 PLN110 1 646201372 PLN110 1 612025601 PLN110 2 1148289352 PLN110 2 1155467049 PLN110 1 660627594 PLN110 1 636764043 PLN110 1 612684114 PLN110 2 1172404752 PLN110 2 1143811555 PLN110 1 660087335 PLN110 1 626870575 PLN111 1 587623253 PLN111 1 607666773 PLN111 1 586243134 PLN111 1 573947504 PLN111 2 1151319163 PLN111 1 663157241 PLN111 1 626857742 PLN111 1 607587567 PLN111 2 1166417974 PLN111 2 1149892400 PLN111 1 660726353 PLN112 1 663525381 PLN112 1 625613366 PLN112 1 606853752 PLN112 1 591973374 PLN112 2 1181333537 PLN112 1 520737098 PLN112 1 659649991 PLN112 1 630477981 PLN112 1 612914000 PLN112 1 592900278 PLN112 1 566194267 PLN113 2 1170194602 PLN113 1 634521465 PLN113 2 1178059891 PLN113 1 626766831 PLN113 1 610506001 PLN113 2 1139699259 PLN113 1 626388232 PLN113 1 525410090 PLN113 1 659109138 PLN113 1 625619081 PLN113 1 605020174 PLN114 52 1140868282 PLN114 2 1144201423 PLN114 2 1150772597 PLN114 1 660123737 PLN114 1 626033862 PLN114 1 611584699 PLN114 2 1146634294 PLN114 1 629468067 PLN114 2 1181536715 PLN114 1 634780758 PLN114 1 613857241 PLN115 3 282488941 PLN115 2 1153523653 PLN115 2 1157943603 PLN115 1 655608708 PLN115 1 630476109 PLN115 1 611734907 PLN115 2 1148834704 PLN115 2 1153026048 PLN115 1 660958633 PLN115 1 628850999 PLN115 1 613418293 PLN116 61 1124765676 PLN116 1 593424848 PLN116 1 555705214 PLN116 2 1149230152 PLN116 1 662192201 PLN116 1 624651312 PLN116 1 607896916 PLN116 2 1144733231 PLN116 1 627906795 PLN116 2 1180743776 PLN116 1 626336238 PLN117 4 316808231 PLN117 1 607408596 PLN117 2 1149881386 PLN117 2 1156807113 PLN117 1 662539114 PLN117 1 634696490 PLN117 1 614659814 PLN117 2 1155079160 PLN117 2 1150818685 PLN117 1 657222892 PLN117 1 629605540 PLN118 35 1154801519 PLN118 1 613053250 PLN118 2 1144594366 PLN118 2 1153001227 PLN118 1 663034619 PLN118 1 623546353 PLN118 1 613383894 PLN118 2 1145099380 PLN118 7 800846786 PLN118 43 1165400665 PLN118 27 869035869 PLN119 33 903586639 PLN119 5 1034335425 PLN119 5 973412539 PLN119 1 454733196 PLN119 2 877648901 PLN119 1 379526086 PLN119 11 1184012898 PLN119 9 226764577 PLN119 27 712893091 PLN119 1 520479541 PLN119 1 655484837 PLN12 1 267785325 PLN120 42 1153994395 PLN120 1 626855960 PLN120 1 604911185 PLN120 1 592828626 PLN120 1 553427711 PLN120 2 1152814527 PLN120 1 631897805 PLN120 1 637173558 PLN120 1 641960388 PLN120 2 1176182574 PLN120 2 1155488842 PLN121 37 1012187192 PLN121 1 660305412 PLN121 1 629753639 PLN121 1 609200707 PLN121 2 1175561398 PLN121 1 633965700 PLN121 2 1180215838 PLN121 1 627226266 PLN121 1 603942392 PLN121 2 1145038912 PLN121 2 1141862336 PLN122 43 1174230866 PLN122 1 661554418 PLN122 1 627699516 PLN122 1 609498991 PLN122 1 588006371 PLN122 1 560132838 PLN122 51 1161837995 PLN122 8 126267343 PLN122 32 1131142309 PLN122 1 369077699 PLN122 1 639092456 PLN123 35 977765170 PLN123 1 650132723 PLN123 2 1119308834 PLN123 1 734473537 PLN123 2 1100022842 PLN123 2 990953513 PLN123 2 1156725275 PLN123 2 921884013 PLN123 1 588888971 PLN123 2 968927852 PLN123 2 1122645515 PLN124 44 1183169112 PLN124 14 393517910 PLN124 35 1168755904 PLN124 3 198866682 PLN124 65 1175961107 PLN124 43 528340211 PLN124 42 792175415 PLN124 1 646201372 PLN124 1 587623253 PLN124 1 663525381 PLN124 2 1170194602 PLN125 61 342767452 PLN125 2 684606446 PLN125 1 525133463 PLN125 1 663523538 PLN125 1 635405230 PLN125 1 611936476 PLN125 2 1150154113 PLN125 2 1161072711 PLN125 1 660736956 PLN125 1 627598042 PLN125 1 612187513 PLN126 12 1080932099 PLN126 2 1155070448 PLN126 1 627617921 PLN126 1 518127376 PLN126 1 673406957 PLN126 1 630137118 PLN126 1 612939186 PLN126 2 1151335502 PLN126 2 1155631783 PLN126 1 657661460 PLN126 1 626889213 PLN127 1 385644068 PLN127 1 610003100 PLN127 2 1148528258 PLN127 1 626222545 PLN127 2 1182281996 PLN127 1 630354994 PLN127 1 612387238 PLN127 1 588087319 PLN127 1 567667584 PLN127 2 1149070389 PLN127 1 653250953 PLN128 2 884812093 PLN128 1 631324550 PLN128 1 609093722 PLN128 2 1149523883 PLN128 2 1145083390 PLN128 1 655260812 PLN128 1 634191159 PLN128 1 614681618 PLN128 1 597998838 PLN128 1 574769137 PLN128 2 1152836532 PLN129 1 446362846 PLN129 1 658721539 PLN129 1 626163282 PLN129 1 609194012 PLN129 2 1153379980 PLN129 2 1162676726 PLN129 1 656359106 PLN129 1 622273932 PLN129 1 610730036 PLN129 1 596985997 PLN129 1 555033258 PLN13 4 963836134 PLN130 2 986227910 PLN130 2 1150333174 PLN130 1 657708949 PLN130 1 625240013 PLN130 1 610861510 PLN130 2 1136292166 PLN130 1 630182139 PLN130 2 1179461484 PLN130 1 624169276 PLN130 1 611474174 PLN130 2 1152158626 PLN131 8 726884344 PLN131 2 1154678582 PLN131 1 664634244 PLN131 1 643202471 PLN131 1 617103718 PLN131 2 1161114768 PLN131 1 645264326 PLN131 2 1178750198 PLN131 1 634680428 PLN131 1 612896067 PLN131 2 1153985512 PLN132 26 967428969 PLN132 2 1159127655 PLN132 1 658111403 PLN132 1 631828453 PLN132 1 612358733 PLN132 2 1172628206 PLN132 2 1161043722 PLN132 1 661402595 PLN132 1 635870417 PLN132 1 617906818 PLN132 2 1154505804 PLN133 2 746994619 PLN133 1 639539621 PLN133 1 522184041 PLN133 1 666500271 PLN133 1 632086707 PLN133 1 607961820 PLN133 2 1173780312 PLN133 21 1134943785 PLN133 25 978183503 PLN133 31 1162575117 PLN133 11 428279349 PLN134 2 884447165 PLN134 10 1182440093 PLN134 88 789475101 PLN134 30 1163880160 PLN134 20 695066696 PLN134 31 1168031906 PLN134 9 308050326 PLN134 25 1164903412 PLN134 4 305227123 PLN134 18 1179459082 PLN134 7 726563806 PLN135 2 918277773 PLN135 13 1145638388 PLN135 21 341478864 PLN135 37 1181166246 PLN135 11 1086198137 PLN135 4 988846570 PLN135 8 855519588 PLN135 17 1122475859 PLN135 28 577307151 PLN135 1 2143528264 PLN135 1 2138631366 PLN136 1 513745672 PLN136 1 2132989935 PLN136 1 2142145023 PLN136 1 2142779784 PLN136 1 124381055 PLN136 1 2112395848 PLN136 1 2144481838 PLN136 1 2133121580 PLN136 1 2141806609 PLN136 1 1870266305 PLN136 1 2134931027 PLN137 44 1177676547 PLN137 1 2108664250 PLN137 1 2146278775 PLN137 1 2117022170 PLN137 1 1576301307 PLN137 1 2067099338 PLN137 1 2134690998 PLN137 1 2136662657 PLN137 1 2140543523 PLN137 1 1531582847 PLN137 1 2146571508 PLN138 26 1140975239 PLN138 1 2138192289 PLN138 1 2101175359 PLN138 1 2146227213 PLN138 1 621086779 PLN138 1 2138605540 PLN138 1 2083688238 PLN138 1 2144314009 PLN138 1 2139184679 PLN138 1 172723629 PLN138 1 2132146989 PLN139 4 331285629 PLN139 1 2133919239 PLN139 1 2133305249 PLN139 1 2100933269 PLN139 1 143347570 PLN139 1 2134142781 PLN139 1 2145201137 PLN139 1 2137733646 PLN139 1 1914313492 PLN139 1 2145479601 PLN139 1 2114166385 PLN14 118 388802600 PLN140 19 1126901545 PLN140 2 3701885723 PLN140 1 2141253099 PLN140 1 2119186544 PLN140 1 2142175433 PLN140 1 1498831827 PLN140 9 1052661862 PLN140 2 289205187 PLN140 15 1117991556 PLN140 31 1043827067 PLN140 2 1130183954 PLN141 16 912358218 PLN141 2 1009393112 PLN141 2 993028308 PLN141 2 1022916012 PLN141 1 567007916 PLN141 2 1019386330 PLN141 3 1015418383 PLN141 2 1022027198 PLN141 1 538841055 PLN141 2 982316280 PLN141 2 970455477 PLN142 66 1141407077 PLN142 2 978300218 PLN142 1 519958927 PLN142 2 968690797 PLN142 3 980008249 PLN142 1 448723479 PLN142 2 1145618670 PLN142 1 480566411 PLN142 2 943080858 PLN142 2 1000998827 PLN142 2 1157028134 PLN143 14 530754150 PLN143 1 478334130 PLN143 2 956665786 PLN143 3 1002859015 PLN143 2 1128818178 PLN143 1 507274784 PLN143 2 948335936 PLN143 2 879747037 PLN143 2 1127570290 PLN143 1 487585716 PLN143 2 938819340 PLN144 31 1163496004 PLN144 3 885120133 PLN144 1 546259763 PLN144 2 942009307 PLN144 1 491835565 PLN144 2 923497301 PLN144 2 944807908 PLN144 2 874182919 PLN144 2 876644296 PLN144 2 959955654 PLN144 2 1006446686 PLN145 7 308663671 PLN145 2 922850811 PLN145 1 420799321 PLN145 2 930959077 PLN145 2 1041934893 PLN145 2 942999660 PLN145 3 908571112 PLN145 2 994915609 PLN145 2 1008745383 PLN145 2 850230395 PLN145 1 470832587 PLN146 15 1140209198 PLN146 2 994476395 PLN146 2 854196926 PLN146 2 912645655 PLN146 2 862849566 PLN146 2 1021576632 PLN146 2 850007440 PLN146 1 367632597 PLN146 2 912116412 PLN146 1 553356059 PLN146 2 966919222 PLN147 72 1144021221 PLN147 2 876261642 PLN147 2 433744592 PLN147 2 997148082 PLN147 1 525597199 PLN147 2 975421395 PLN147 3 998127563 PLN147 1 531985519 PLN147 2 997566044 PLN147 1 499943225 PLN147 2 945126499 PLN148 61 1159163589 PLN148 2 977083963 PLN148 2 1036274906 PLN148 1 477529720 PLN148 3 1105984004 PLN148 2 1091311779 PLN148 2 928973494 PLN148 3 547302110 PLN148 2 949186154 PLN148 2 998536841 PLN148 2 803475842 PLN149 77 196425373 PLN149 2 950330420 PLN149 2 1091972596 PLN149 2 995224407 PLN149 2 973886503 PLN149 1 444660800 PLN149 2 1023553300 PLN149 2 914623388 PLN149 2 836746646 PLN149 1 432790581 PLN149 2 1058778957 PLN15 65 1139137459 PLN150 89 1079795203 PLN150 2 930200695 PLN150 1 398551120 PLN150 3 942162386 PLN150 1 488646431 PLN150 2 919820886 PLN150 2 904199719 PLN150 1 469438496 PLN150 2 897026796 PLN150 1 532902629 PLN150 2 948044567 PLN151 12 550367550 PLN151 2 935988512 PLN151 1 436072789 PLN151 2 1096125550 PLN151 1 474248680 PLN151 2 870794531 PLN151 2 886494923 PLN151 2 1089597455 PLN151 1 410174162 PLN151 2 893651928 PLN151 3 1146413290 PLN152 58 1176452154 PLN152 1 827770304 PLN152 1 819590567 PLN152 1 657919172 PLN152 1 735222392 PLN152 1 640551262 PLN152 2 850883630 PLN152 1 641523445 PLN152 1 830702509 PLN152 1 817725293 PLN152 1 657518596 PLN153 15 525826380 PLN153 1 728079018 PLN153 1 637620844 PLN153 2 841520699 PLN153 2 787615973 PLN153 1 547589534 PLN153 2 929522122 PLN153 2 918166143 PLN153 2 806717380 PLN153 2 940422912 PLN153 1 481399899 PLN154 8 1100763882 PLN154 2 951785915 PLN154 1 437373607 PLN154 2 1059882713 PLN154 2 918539616 PLN154 1 395065095 PLN154 2 968208187 PLN154 2 1065368112 PLN154 2 928206292 PLN154 1 420024747 PLN154 32 1127028223 PLN155 12 876120058 PLN155 3 189270989 PLN155 28 1129046251 PLN155 48 399992240 PLN155 30 1163643496 PLN155 10 243332908 PLN155 50 1168645895 PLN155 24 1108652219 PLN155 55 1166738942 PLN155 55 1162954495 PLN155 15 248922058 PLN156 107 1113094433 PLN156 36 1121022866 PLN156 5 495551257 PLN156 41 1178973598 PLN156 52 1171134433 PLN156 7 194512759 PLN156 24 1161318370 PLN156 20 798845768 PLN156 9 453146765 PLN156 2 3545513960 PLN156 1 1499997841 PLN157 10 393899286 PLN157 1 1493209057 PLN157 1 1187610474 PLN157 1 943684407 PLN157 8 1161825966 PLN157 10 678190269 PLN157 60 1123620493 PLN157 35 1103233680 PLN157 46 1169631932 PLN157 11 202846913 PLN157 42 1174046069 PLN158 37 1157200342 PLN158 17 875971355 PLN158 1 495016746 PLN158 1 767071137 PLN158 1 671256291 PLN158 1 670741101 PLN158 1 671191297 PLN158 1 771176557 PLN158 1 643128204 PLN158 1 694350238 PLN158 1 641290954 PLN159 34 484801414 PLN159 2 1174904300 PLN159 1 745638687 PLN159 8 1174732410 PLN159 2 147868549 PLN159 35 1182764044 PLN159 5 172411700 PLN159 15 1137951826 PLN159 5 302966115 PLN159 38 966678693 PLN159 1 276062833 PLN16 19724 632039832 PLN160 109 1066016693 PLN160 4 1030454020 PLN160 3 601928786 PLN160 4 1044647336 PLN160 12 971273463 PLN160 63 1078890326 PLN160 5 1171014872 PLN160 2 414484519 PLN160 6 1075986347 PLN160 5 1011739439 PLN160 3 641040368 PLN161 3 217459947 PLN161 6 1155659052 PLN161 6 1180680467 PLN161 1 226440888 PLN161 6 1183825192 PLN161 1 144960904 PLN161 4 596865443 PLN161 1 956684326 PLN161 1 561974515 PLN161 1 718270646 PLN161 1 682093502 PLN162 45 1150354114 PLN162 1 700447244 PLN162 1 683485999 PLN162 1 723946829 PLN162 1 751391258 PLN162 1 651249186 PLN162 2 1175723351 PLN162 2 1136845382 PLN162 44 1170528899 PLN162 33 350013929 PLN162 71 1093753674 PLN163 26 1026200593 PLN163 4 296118519 PLN163 50 1034374597 PLN163 39 1073881614 PLN163 15 186744529 PLN163 55 1086348695 PLN163 9 812247399 PLN163 13 1182713933 PLN163 5 235556068 PLN163 40 1180635522 PLN163 42 459035655 PLN164 1 252054568 PLN164 102 1172312507 PLN164 33 462172122 PLN164 96 1181631126 PLN164 17 485320651 PLN164 8 996864010 PLN164 2 641905789 PLN164 17 1163882844 PLN164 10 553844493 PLN164 8 1153933128 PLN164 16 907583600 PLN165 3 968319031 PLN165 61 1171051519 PLN165 27 734261416 PLN165 61 1176014371 PLN165 24 731321476 PLN165 13 1180963047 PLN165 5 688244352 PLN165 14 1163113056 PLN165 16 805479925 PLN165 23 1022775770 PLN165 10 746646445 PLN166 1 372789172 PLN166 16 1011906545 PLN166 135145 467188272 PLN167 22 1167044508 PLN168 11 374752144 PLN169 23 1153098306 PLN17 96584 101383193 PLN170 26 1154548503 PLN171 1 35730237 PLN172 46 1154003332 PLN173 33 1110400232 PLN174 35 1182511832 PLN175 22 740099219 PLN176 34 1161530233 PLN177 25 854672730 PLN178 34 1157604427 PLN179 24 825387235 PLN18 113437 117621940 PLN180 35 1172475088 PLN181 12 446630180 PLN182 26 1149300899 PLN183 5 554209616 PLN184 8 1169179641 PLN185 3 366576483 PLN186 9 1069109235 PLN187 5 734894067 PLN188 8 1084336480 PLN189 5 513878443 PLN19 57311 72144580 PLN190 8 1129219417 PLN191 4 564629152 PLN192 10 1173787899 PLN193 4 564390138 PLN194 184 1183675910 PLN195 307 1012676673 PLN196 37 16871 PLN197 149 79314 PLN198 2469 93786416 PLN199 7181 18795412 PLN2 101394 600277276 PLN20 28689 28922869 PLN200 14346 29953091 PLN201 227168 299417720 PLN202 379449 326289045 PLN203 273015 666394656 PLN204 72044 110626104 PLN205 98644 85504671 PLN206 49729 72847341 PLN207 25060 110564695 PLN208 21867 892692548 PLN209 1872 1106451307 PLN21 3409 722549176 PLN210 8 500798893 PLN211 513 1049508159 PLN212 1 474651383 PLN213 1 612216829 PLN214 1 571018318 PLN215 2 1112570752 PLN216 130 1162682290 PLN217 13681 570195101 PLN218 198960 140044002 PLN219 384628 373799778 PLN22 181 156660490 PLN220 343659 278663977 PLN221 274523 291245428 PLN222 283673 242537252 PLN223 237398 271582332 PLN224 382373 479091593 PLN225 21551 19736583 PLN226 323192 495932462 PLN227 287063 593183218 PLN228 21492 414505005 PLN229 30271 986119976 PLN23 1125 877653193 PLN230 3295 696602499 PLN231 1392 566152517 PLN232 1283 755100775 PLN233 1 675310294 PLN234 1 628753756 PLN235 1 624247919 PLN236 2 1172266179 PLN237 8564 784313867 PLN238 1 727344967 PLN239 1 946003158 PLN24 109 78230336 PLN240 1 965754312 PLN241 1 906459801 PLN242 1 876148008 PLN243 1 885153844 PLN244 1 899925126 PLN245 4163 1100106582 PLN246 8 255456585 PLN247 543 1092756245 PLN248 129 281783689 PLN249 206 92200731 PLN25 690 1012117390 PLN250 64 1045685747 PLN251 1 696809892 PLN252 1 655542733 PLN253 1 648987779 PLN254 1 622068216 PLN255 1 583456046 PLN256 132 1176770373 PLN257 1 675310294 PLN258 1 628753756 PLN259 1 624247919 PLN26 371 1062942605 PLN260 2 1172266179 PLN261 345 729691402 PLN262 1 521073757 PLN263 1 672273650 PLN264 1 634137895 PLN265 1 624121443 PLN266 2 1171800569 PLN267 2 1153005584 PLN268 1 661076038 PLN269 1 626572591 PLN27 255 1101294268 PLN270 1 612852138 PLN271 2 1169525711 PLN272 2 1136827172 PLN273 1 653624577 PLN274 1 616219606 PLN275 1 610044819 PLN276 2 1134152592 PLN277 2 1156707404 PLN278 1 685423969 PLN279 1 640667275 PLN28 29 802880115 PLN280 1 639123876 PLN281 1 612949391 PLN282 1 577192767 PLN283 1 641629864 PLN284 2 1148934912 PLN285 1 604770208 PLN286 2 1173859433 PLN287 1 556080982 PLN288 2 1115335392 PLN289 1 652551272 PLN29 118 1157726217 PLN290 1 615767531 PLN291 1 605571303 PLN292 1 592249714 PLN293 4 1166268162 PLN294 1 550024188 PLN295 1 710194481 PLN296 1 661081403 PLN297 1 659460550 PLN298 1 630572514 PLN299 1 598618390 PLN3 197597 419771519 PLN30 73 555012493 PLN300 1 658974642 PLN301 1 559656399 PLN302 1 717517502 PLN303 1 672450454 PLN304 1 665297378 PLN305 1 636785599 PLN306 1 599706080 PLN307 1 675658265 PLN308 1 523168208 PLN309 1 671211297 PLN31 74 124609184 PLN310 1 630677708 PLN311 1 623428415 PLN312 1 604298040 PLN313 1 558526623 PLN314 2 1124081839 PLN315 1 640830439 PLN316 1 597781253 PLN317 1 600363860 PLN318 2 1105176863 PLN319 2 1154056276 PLN32 15 1076501108 PLN320 1 685947972 PLN321 1 649921694 PLN322 1 641099225 PLN323 1 611845738 PLN324 1 581041262 PLN325 2 1176958498 PLN326 1 667717957 PLN327 1 631819663 PLN328 1 624692602 PLN329 1 597351075 PLN33 3 422359550 PLN330 1 561737938 PLN331 2 1154165677 PLN332 1 670202054 PLN333 1 631946783 PLN334 1 626743494 PLN335 2 1167772850 PLN336 2 1151941538 PLN337 1 671530377 PLN338 1 631910401 PLN339 1 622474059 PLN34 49 1134143683 PLN340 2 1160377439 PLN341 2 1159528938 PLN342 1 684336246 PLN343 1 636053469 PLN344 1 629969872 PLN345 2 1172688001 PLN346 2 1160045407 PLN347 1 665715246 PLN348 1 624683667 PLN349 1 621078253 PLN35 31 548900587 PLN350 2 1159864294 PLN351 2 1170185454 PLN352 1 697540743 PLN353 1 655862368 PLN354 1 646765634 PLN355 1 618540729 PLN356 1 587963859 PLN357 455 1147653963 PLN358 10 201809768 PLN359 21 707743781 PLN36 21 1180521825 PLN360 1 705338699 PLN361 1 493450010 PLN362 1 804285258 PLN363 1 810734643 PLN364 1 673981989 PLN365 1 754496630 PLN366 1 855759449 PLN367 1 614042580 PLN368 1 743847818 PLN369 1 673340788 PLN37 47 381546474 PLN370 1 515668560 PLN371 1 713320806 PLN372 1 703598484 PLN373 1 570159854 PLN374 1 625793224 PLN375 1 721110502 PLN376 1 459355444 PLN377 1 745201001 PLN378 1 749284433 PLN379 1 643344672 PLN38 159 1056502701 PLN380 1 595297365 PLN381 1 688905267 PLN382 1 491807393 PLN383 1 769338634 PLN384 1 671568023 PLN385 1 635285330 PLN386 1 745618965 PLN387 1 839470345 PLN388 1 646400022 PLN389 1 747589525 PLN39 125 832265940 PLN390 2 1171764895 PLN391 1 703962928 PLN392 1 702438406 PLN393 2 1178978634 PLN394 2 1173154747 PLN395 1 734536914 PLN396 1 738743901 PLN397 1 636778132 PLN398 1 602900890 PLN399 1 697493198 PLN4 54154 448569398 PLN40 213 995602210 PLN400 1 490518203 PLN401 1 784661008 PLN402 1 810500911 PLN403 1 655314739 PLN404 1 752710991 PLN405 1 890847171 PLN406 1 621781073 PLN407 1 743084022 PLN408 1 676741658 PLN409 1 509452426 PLN41 32 996843807 PLN410 1 710124532 PLN411 2 1058788934 PLN412 1 620140791 PLN413 1 716573881 PLN414 1 476726550 PLN415 1 756324664 PLN416 1 977471539 PLN417 2 1144819353 PLN418 1 646234737 PLN419 1 605172934 PLN42 73 639978110 PLN420 1 593744788 PLN421 2 1117445025 PLN422 1 607667504 PLN423 1 590561804 PLN424 2 1176631761 PLN425 1 782694893 PLN426 1 796420183 PLN427 1 650274702 PLN428 1 739889549 PLN429 1 848590828 PLN43 4 991306162 PLN430 1 610626473 PLN431 1 738023571 PLN432 2 1173882462 PLN433 1 701434008 PLN434 1 690770133 PLN435 1 567265955 PLN436 1 612987783 PLN437 1 704156067 PLN438 1 475327881 PLN439 1 732118298 PLN44 1 296818136 PLN440 1 733931846 PLN441 1 636796232 PLN442 1 599764323 PLN443 1 691313424 PLN444 1 493357854 PLN445 1 782685093 PLN446 1 786410271 PLN447 1 648139033 PLN448 1 744407562 PLN449 1 835583350 PLN45 5 1159558460 PLN450 1 623221719 PLN451 1 741299132 PLN452 1 669032550 PLN453 1 517040482 PLN454 1 711661679 PLN455 1 708205786 PLN456 2 1156892395 PLN457 2 1178356817 PLN458 1 737453356 PLN459 1 736349413 PLN46 56 233110334 PLN460 1 639162162 PLN461 1 586755746 PLN462 1 704478343 PLN463 1 492109999 PLN464 1 791475352 PLN465 1 785940626 PLN466 1 661246824 PLN467 1 756990402 PLN468 1 858776195 PLN469 1 621195942 PLN47 21 1168726770 PLN470 1 754256086 PLN471 1 670301833 PLN472 1 509263899 PLN473 1 708234589 PLN474 1 725120110 PLN475 1 575129590 PLN476 1 620883766 PLN477 1 727285804 PLN478 1 479660269 PLN479 1 745978486 PLN48 1 157681923 PLN480 1 750160716 PLN481 1 642428577 PLN482 1 591313643 PLN483 1 705330581 PLN484 1 495656580 PLN485 1 803232604 PLN486 1 790745243 PLN487 1 657494025 PLN488 1 759305888 PLN489 1 856542542 PLN49 184 1170332002 PLN490 1 628321883 PLN491 1 754364263 PLN492 1 697113365 PLN493 1 504254270 PLN494 1 715354979 PLN495 1 713929667 PLN496 1 572943128 PLN497 1 626959190 PLN498 1 715714221 PLN499 1 483823121 PLN5 32073 942678547 PLN50 52 491981677 PLN500 1 742917797 PLN501 1 748536659 PLN502 1 643784981 PLN503 1 600654286 PLN504 2 1171400808 PLN505 1 794150360 PLN506 1 799857935 PLN507 1 655329108 PLN508 1 749763888 PLN509 1 838116175 PLN51 8 1074474850 PLN510 1 610468321 PLN511 1 736551279 PLN512 2 1171154657 PLN513 2 1170482349 PLN514 1 566465558 PLN515 1 614421429 PLN516 2 1179310235 PLN517 1 735408736 PLN518 1 969998116 PLN519 11 635028102 PLN52 48 777884683 PLN520 1 595339094 PLN521 1 698605642 PLN522 1 499102108 PLN523 1 791748890 PLN524 1 797311483 PLN525 1 656817438 PLN526 1 753360318 PLN527 1 845838138 PLN528 1 619661694 PLN529 1 752772853 PLN53 76 1120919626 PLN530 1 689709469 PLN531 1 509595892 PLN532 1 712797596 PLN533 1 710493282 PLN534 1 570643040 PLN535 1 619886155 PLN536 1 705533140 PLN537 1 484551304 PLN538 1 740148362 PLN539 1 757233630 PLN54 18 645106926 PLN540 1 642499559 PLN541 1 594006513 PLN542 1 693261537 PLN543 1 492948387 PLN544 1 781462734 PLN545 1 802944975 PLN546 1 650275864 PLN547 1 756841830 PLN548 1 850623622 PLN549 1 614136911 PLN55 337 1002760898 PLN550 1 723255126 PLN551 2 1177410070 PLN552 1 712168462 PLN553 1 712339524 PLN554 1 564869106 PLN555 1 619418949 PLN556 1 715454519 PLN557 1 478264344 PLN558 1 734693445 PLN559 1 749685439 PLN56 121 251819355 PLN560 1 633598967 PLN561 1 782818162 PLN562 1 1022071454 PLN563 1 971920087 PLN564 1 827198496 PLN565 1 867619200 PLN566 1 806566123 PLN567 1 1015700474 PLN568 1 742303966 PLN569 1 956173857 PLN57 433 1050481664 PLN570 1 916702776 PLN571 1 874517040 PLN572 1 816294110 PLN573 1 750216944 PLN574 21 862613184 PLN575 176 657269103 PLN576 1 665585731 PLN577 1 621516506 PLN578 1 610333535 PLN579 2 1150013201 PLN58 99 698308529 PLN580 119 632628552 PLN581 4 1055123987 PLN582 2 399259151 PLN583 773 1136041142 PLN584 18 958385885 PLN585 3 1008669690 PLN586 16454 1068645461 PLN587 5636 1862075 PLN588 7252 957026037 PLN589 1 594102056 PLN59 430 1173128636 PLN590 1 689851870 PLN591 1 495453186 PLN592 1 780798557 PLN593 1 801256715 PLN594 1 651852609 PLN595 1 750843639 PLN596 1 830829764 PLN597 1 615552423 PLN598 1 744588157 PLN599 1 673617499 PLN6 46 124218893 PLN60 127 437592776 PLN600 1 509857067 PLN601 1 709773743 PLN602 1 713149757 PLN603 1 566080677 PLN604 1 618079260 PLN605 1 720988478 PLN606 1 473592718 PLN607 1 736706236 PLN608 1 750620385 PLN609 2578 1146365542 PLN61 105 1134076865 PLN610 4108 303878996 PLN611 15611 709441102 PLN612 1 585266722 PLN613 1 681112512 PLN614 1 775448786 PLN615 1 790338525 PLN616 1 746673839 PLN617 1 836514780 PLN618 1 736872137 PLN619 1 676292951 PLN62 111 220031698 PLN620 1 669155517 PLN621 1 701372996 PLN622 1 615672275 PLN623 1 698614761 PLN624 1 728031845 PLN625 12303 731451465 PLN626 94681 142561266 PLN627 280498 582157750 PLN628 302413 570758891 PLN629 15820 37737542 PLN63 162 1085904129 PLN630 246081 636632506 PLN631 45686 143540254 PLN632 201296 690380000 PLN633 2873 16285478 PLN634 160482 731870821 PLN635 27007 86980451 PLN636 166190 727890154 PLN637 128441 590542724 PLN638 169300 731548911 PLN639 54900 195093939 PLN64 337 692989072 PLN640 134091 782940810 PLN641 53290 312375310 PLN642 202091 708206956 PLN643 33539 196057383 PLN644 175477 722794878 PLN645 11923 683457356 PLN646 1 528447123 PLN647 1 678170541 PLN648 1 639558213 PLN649 1 629672760 PLN65 172 1104865850 PLN650 1 608467472 PLN651 1 565695744 PLN652 2 1166970321 PLN653 1 684376481 PLN654 1 642597466 PLN655 1 631979072 PLN656 1 607115911 PLN657 1 582960187 PLN658 1 640026769 PLN659 1 608979116 PLN66 16 282568200 PLN660 1 720972993 PLN661 1 501257520 PLN662 1 804602427 PLN663 1 808121247 PLN664 1 649118519 PLN665 1 758906661 PLN666 1 861141126 PLN667 1 642382296 PLN668 1 759893476 PLN669 1 689766370 PLN67 224 1167597370 PLN670 1 531462149 PLN671 1 714517032 PLN672 1 717288350 PLN673 1 586345039 PLN674 1 626266972 PLN675 1 738085275 PLN676 1 505809789 PLN677 1 759124079 PLN678 1 751612808 PLN679 12 1160338339 PLN68 96 448470916 PLN680 685 1037884752 PLN681 2 1145861525 PLN682 2 1112884977 PLN683 1 477706438 PLN684 2 875660940 PLN685 2 924439243 PLN686 1 481348281 PLN687 2 896921305 PLN688 2 995026189 PLN689 2 869378871 PLN69 10 1182999913 PLN690 2 922541915 PLN691 2 917029648 PLN692 1 538887009 PLN693 1 574640544 PLN694 1 667652801 PLN695 2 1153333809 PLN696 2 976557482 PLN697 2 971318115 PLN698 2 905021021 PLN699 2 779060037 PLN7 4357 1078154010 PLN70 9 1033145339 PLN700 2 1026993414 PLN701 2 1040398764 PLN702 2 906287378 PLN703 2 1107801300 PLN704 2 1085890887 PLN705 1 588203704 PLN706 2 1015273266 PLN707 2 965280586 PLN708 1 582703961 PLN709 2 1026383973 PLN71 9 1070832115 PLN710 2 1018992133 PLN711 20 537195591 PLN712 1 613662638 PLN713 1 794474755 PLN714 1 760111594 PLN715 1 769810128 PLN716 1 715684684 PLN717 1 623890083 PLN718 1 755457679 PLN719 1 717109572 PLN72 10 1167983468 PLN720 1 817712742 PLN721 1 864624966 PLN722 1 701857263 PLN723 1 726425509 PLN724 1 738041677 PLN725 1 767912069 PLN726 1 504659958 PLN727 1 662526948 PLN728 2 1167934623 PLN729 2 1091547167 PLN73 6 1041755176 PLN730 3 1082389428 PLN731 2 582533673 PLN732 3 942215135 PLN733 1 354403191 PLN734 316 1102146609 PLN735 37 1037827543 PLN736 74 199331596 PLN737 436 1166298862 PLN738 26 992712695 PLN739 4 1158055928 PLN74 2 356433379 PLN740 2 1135086767 PLN741 2 1031765593 PLN742 149 1154467731 PLN743 23 858680371 PLN744 1053 1144769269 PLN745 1 703076930 PLN746 1 495911329 PLN747 1 796169439 PLN748 1 779372321 PLN749 1 665561653 PLN75 63 1173046176 PLN750 1 757165295 PLN751 1 852704148 PLN752 1 623698249 PLN753 1 745048881 PLN754 1 677947850 PLN755 1 524289323 PLN756 1 726838826 PLN757 1 701430346 PLN758 1 584133940 PLN759 1 622677745 PLN76 182 756898379 PLN760 1 745712656 PLN761 1 490622797 PLN762 1 748850018 PLN763 1 753856519 PLN764 700 674126380 PLN765 1 593930347 PLN766 1 702775664 PLN767 1 494594617 PLN768 1 792837209 PLN769 1 812232696 PLN77 117 1159004230 PLN770 1 661835603 PLN771 1 750337041 PLN772 1 854463248 PLN773 1 623248023 PLN774 1 749950614 PLN775 1 673746810 PLN776 1 520815567 PLN777 1 712547961 PLN778 1 703299309 PLN779 1 569771178 PLN78 12 1141850928 PLN780 1 620176429 PLN781 1 717542863 PLN782 1 493761083 PLN783 1 746502734 PLN784 1 752612656 PLN785 573 686952725 PLN786 2 990024350 PLN787 2 888868060 PLN788 1 485323027 PLN789 2 941973305 PLN79 5 1125968574 PLN790 2 1051914856 PLN791 1 638425132 PLN792 1 716105986 PLN793 1 613160974 PLN794 2 1177939381 PLN795 2 1016319037 PLN796 1 480949782 PLN797 2 954568201 PLN798 1 298028472 PLN799 242 1168816031 PLN8 77 711343148 PLN80 2 359637190 PLN800 310 746899521 PLN801 133 749981360 PLN802 1 702775664 PLN803 1 494594617 PLN804 1 792837209 PLN805 1 812232696 PLN806 1 661835603 PLN807 1 750337041 PLN808 1 854463248 PLN809 1 623248023 PLN81 283 1034403005 PLN810 1 749950614 PLN811 1 673746810 PLN812 1 520815567 PLN813 1 712547961 PLN814 1 703299309 PLN815 1 569771178 PLN816 1 620176429 PLN817 1 717542863 PLN818 1 493761083 PLN819 1 746502734 PLN82 40 1075820283 PLN820 1 752612656 PLN821 233 1180834457 PLN822 6503 509584943 PLN823 1 657893865 PLN824 2 1156686622 PLN825 2 1150914040 PLN826 5 626957076 PLN827 103 1176215683 PLN828 32 874057681 PLN829 59 1170613979 PLN83 3 424655429 PLN830 37 890565897 PLN831 42 1157660304 PLN832 33 916538999 PLN833 38 1124061822 PLN834 19 958397564 PLN835 35 1145742472 PLN836 11 421835350 PLN837 39 1163413684 PLN838 178 739865527 PLN839 10 1112532336 PLN84 8 1102481801 PLN840 120 1115935246 PLN841 5 402339329 PLN842 21 1180552620 PLN843 8 416782388 PLN844 279 1134361485 PLN845 9 315307783 PLN846 4 1080552710 PLN847 2 438380923 PLN848 43 1145344578 PLN849 13 1126392473 PLN85 2 540692104 PLN850 119 245112629 PLN851 23 1093148685 PLN852 5 422767247 PLN853 24 1165880814 PLN854 189 569374133 PLN855 1 599230268 PLN856 1 709345803 PLN857 1 499575344 PLN858 1 795989443 PLN859 1 809120074 PLN86 4 991095321 PLN860 1 670531570 PLN861 1 759055895 PLN862 1 872909281 PLN863 1 637083831 PLN864 1 765902670 PLN865 1 688536368 PLN866 1 533804092 PLN867 1 714878730 PLN868 1 728610199 PLN869 1 586077705 PLN87 2 509157458 PLN870 1 622419581 PLN871 1 733835468 PLN872 1 506756789 PLN873 1 759450946 PLN874 1 768174826 PLN875 3 659068422 PLN876 1 865431811 PLN877 1 841368522 PLN878 1 772393794 PLN879 1 766078222 PLN88 23 1166540265 PLN880 1 735900830 PLN881 1 693266847 PLN882 1 690056233 PLN883 1 654671025 PLN884 1 681539918 PLN885 1 650134427 PLN886 1 643737533 PLN887 2 1092839925 PLN888 1 528421643 PLN889 2 1025960110 PLN89 259 1173013079 PLN890 1 484156440 PLN891 13 427663120 PLN892 1 1574527093 PLN893 1 1805244829 PLN894 1 1716769615 PLN895 1 1637815978 PLN896 1 1645877737 PLN897 1 1365994436 PLN898 1 1520236431 PLN899 8 34567157 PLN9 32 1155338215 PLN90 3 110045716 PLN900 13 790727573 PLN901 1 660114068 PLN902 1 623862790 PLN903 1 606413785 PLN904 2 1155915948 PLN905 1 627107635 PLN906 2 1184046427 PLN907 1 626943711 PLN908 1 613583204 PLN909 1 592677528 PLN91 17 900773506 PLN910 1 559914542 PLN911 2 1147808788 PLN912 1 656479363 PLN913 1 621609376 PLN914 1 611088072 PLN915 2 1140013277 PLN916 2 1154214120 PLN917 1 661498744 PLN918 1 626053568 PLN919 1 608346219 PLN92 1 594546470 PLN920 2 1151823422 PLN921 1 639402856 PLN922 1 523218450 PLN923 1 661546608 PLN924 1 633922074 PLN925 1 612932250 PLN926 1 591516528 PLN927 2 1182689651 PLN928 1 530821096 PLN929 1 664715623 PLN93 2 1174734371 PLN930 1 631770265 PLN931 1 613234972 PLN932 1 604325310 PLN933 1 582152544 PLN934 2 1158575799 PLN935 1 661621317 PLN936 1 626868012 PLN937 1 607094319 PLN938 2 1149874108 PLN939 2 1149787837 PLN94 2 1111268940 PLN940 1 656602423 PLN941 1 622110859 PLN942 1 612883152 PLN943 2 1142529769 PLN944 2 1154234909 PLN945 1 656789389 PLN946 1 625372561 PLN947 1 603451504 PLN948 2 1159731212 PLN949 2 1150269419 PLN95 28 1135832320 PLN950 1 657552530 PLN951 1 618447767 PLN952 1 613586716 PLN953 2 1143934454 PLN954 1 631620540 PLN955 1 521019562 PLN956 1 676241010 PLN957 1 632313166 PLN958 1 603807353 PLN959 2 1155326502 PLN96 19 506053923 PLN960 2 1150412865 PLN961 1 662000247 PLN962 1 633487160 PLN963 1 612164168 PLN964 1 594048367 PLN965 1 565074362 PLN966 2 1150238410 PLN967 1 660449817 PLN968 1 627269420 PLN969 1 602651360 PLN97 25 1176429757 PLN970 2 1162506895 PLN971 2 1158496591 PLN972 1 664401522 PLN973 1 626503588 PLN974 1 611188438 PLN975 2 1171231026 PLN976 1 639824632 PLN977 2 1173957386 PLN978 1 621715108 PLN979 1 610707416 PLN98 57 1173826657 PLN980 1 589489225 PLN981 1 558356414 PLN982 2 1151723189 PLN983 1 660500976 PLN984 1 634743673 PLN985 1 616002081 PLN986 2 1150169128 PLN987 2 1153490048 PLN988 1 669356984 PLN989 1 631173187 PLN99 8 204748821 PLN990 1 607766370 PLN991 2 1145806163 PLN992 2 1143277701 PLN993 1 664077638 PLN994 1 624178744 PLN995 1 609451706 PLN996 2 1144639091 PLN997 1 631526965 PLN998 1 660034972 PLN999 1 625104971 PRI1 23047 60053106 PRI10 2242 1049737833 PRI11 7 1054721751 PRI12 9619 1167759726 PRI13 51713 80725821 PRI14 53151 979836358 PRI15 9 1175135830 PRI16 5 991549712 PRI17 7 910099250 PRI18 6 1153842615 PRI19 11 1048068825 PRI2 28864 1050341494 PRI20 8 1079976827 PRI21 7 985425849 PRI22 10 1151487527 PRI23 11 1110746497 PRI24 2 278974018 PRI25 7 1151013097 PRI26 127671 939740267 PRI27 52008 101670651 PRI28 163401 559900232 PRI29 169220 642798216 PRI3 4703 636595787 PRI30 107949 842809822 PRI31 11829 60187941 PRI32 117247 875892199 PRI33 164 426290540 PRI34 772 1171021624 PRI35 56852 812922290 PRI4 8333 1104652402 PRI5 8708 961605218 PRI6 19803 634234652 PRI7 27929 79132073 PRI8 96050 166265556 PRI9 30070 1101152567 ROD1 42159 1008837853 ROD10 12 1077235365 ROD100 6 568551949 ROD101 13 1057276660 ROD102 3 482785390 ROD103 11 1120709301 ROD104 11 954882810 ROD105 11 1138251811 ROD106 17 1102190201 ROD107 7 1067152563 ROD108 6 668123932 ROD109 16 1131848017 ROD11 4 763441177 ROD110 7 689992124 ROD111 19 1156972737 ROD112 5 609164690 ROD113 13 1146902586 ROD114 13 706688834 ROD115 11 1146173548 ROD116 148 1098231299 ROD117 1 200613070 ROD118 7 1092870110 ROD119 13 1146606716 ROD12 8 1167428371 ROD120 27085 192469579 ROD13 161 918978924 ROD14 7 1078339014 ROD15 5 617359317 ROD16 89 1130749860 ROD17 5 531191793 ROD18 15 1161179778 ROD19 7 553671745 ROD2 4239 782462163 ROD20 19 1172805098 ROD21 98210 627840144 ROD22 8 1096445171 ROD23 11 1065805777 ROD24 8 1087503260 ROD25 10 859668626 ROD26 7 1065740602 ROD27 110 1130872454 ROD28 10 1095487923 ROD29 4 611448462 ROD3 5925 1106303123 ROD30 9 1170792484 ROD31 7 1007233338 ROD32 12 1139805638 ROD33 7 1102147628 ROD34 10 1155930739 ROD35 11 1098049524 ROD36 9 1150323287 ROD37 9 1170918579 ROD38 9 1178699347 ROD39 10 1042031390 ROD4 16388 354458066 ROD40 2 334811729 ROD41 8 1108112131 ROD42 11 1166769479 ROD43 1 157584965 ROD44 8 1106421483 ROD45 11 1096468690 ROD46 2 245275529 ROD47 10 1105189242 ROD48 9 1153800168 ROD49 1 177680146 ROD5 23215 505710838 ROD50 8 1124775391 ROD51 11 1014425308 ROD52 2 370341452 ROD53 8 1135703989 ROD54 6 684815851 ROD55 10 1148623723 ROD56 5 671349488 ROD57 11 1011717511 ROD58 5 821705591 ROD59 9 1145859896 ROD6 303403 646139146 ROD60 8 740870690 ROD61 7 1083840393 ROD62 10 1142364021 ROD63 3 146446812 ROD64 10 1150647282 ROD65 8 1094459808 ROD66 3 269228856 ROD67 10 1152930414 ROD68 4 578343561 ROD69 19 1066268739 ROD7 97485 65752145 ROD70 8 876855184 ROD71 19 1151436343 ROD72 6 649442391 ROD73 12 1119919372 ROD74 21 1026661546 ROD75 1 188060799 ROD76 8 1175090281 ROD77 7 697432909 ROD78 12 1037257517 ROD79 6 916476668 ROD8 40624 989063787 ROD80 10 1136813612 ROD81 6 757758797 ROD82 8 1083186456 ROD83 10 1065713492 ROD84 1 184589612 ROD85 7 1082392531 ROD86 9 1050453265 ROD87 9 1140334745 ROD88 11 1018693748 ROD89 10 1099288471 ROD9 5 747888891 ROD90 8 967904117 ROD91 13 1050156797 ROD92 9 1142937325 ROD93 14 1036322534 ROD94 6 975869499 ROD95 13 1164045684 ROD96 9 1064632113 ROD97 11 1130583323 ROD98 8 525643352 ROD99 7 1113949024 STS1 322255 155037062 STS2 325270 215137713 STS3 330216 149930483 STS4 369247 120817879 SYN1 54450 995654191 SYN10 135752 848257181 SYN11 56055 402173564 SYN2 5 418163749 SYN3 7 1026747849 SYN4 7 905174914 SYN5 9 1164048999 SYN6 7 771284004 SYN7 6 1076407027 SYN8 333 913831861 SYN9 66393 241027112 TSA1 530474 190965098 TSA10 107955 75847634 TSA11 421728 180662797 TSA12 453722 281751974 TSA13 496775 439245490 TSA14 151611 162821539 TSA15 478101 442403965 TSA16 69555 96695981 TSA17 540330 380298629 TSA18 75992 43161511 TSA19 472069 354771593 TSA2 431253 271169054 TSA20 472700 346803005 TSA21 485077 345824164 TSA22 447500 371642457 TSA23 137157 81320982 TSA24 510932 439399615 TSA25 58986 96878191 TSA26 386750 404742785 TSA27 386747 295816167 TSA28 515188 355802485 TSA29 41717 39146972 TSA3 450976 244523399 TSA30 402182 380481762 TSA31 1332 456025 TSA32 350087 279521147 TSA33 350088 306834608 TSA34 506159 408010496 TSA35 176936 190058946 TSA36 519423 404484025 TSA37 32591 22930116 TSA38 309272 251629584 TSA39 263445 683524151 TSA4 423423 363034342 TSA40 30090 107284106 TSA41 321401 286606614 TSA42 33866 32890162 TSA43 225626 184706695 TSA44 67909 19803915 TSA45 252490 65705875 TSA46 134255 46673193 TSA47 386745 358263417 TSA48 400786 529016441 TSA49 111964 240609423 TSA5 391580 314616150 TSA50 391566 529635074 TSA51 121185 168266178 TSA52 431861 456395607 TSA53 94591 61299880 TSA54 451898 419220916 TSA55 123499 121448278 TSA6 443854 278464186 TSA7 576449 352192162 TSA8 23841 14335953 TSA9 545119 359475407 UNA1 769 4547944 VRL1 351165 457406579 VRL10 238615 459098915 VRL100 26044 663939957 VRL101 11626 345235602 VRL102 22860 665086056 VRL103 11858 343538398 VRL104 23413 665701550 VRL105 10928 324701294 VRL106 23119 666015001 VRL107 11606 339734423 VRL108 23789 665031434 VRL109 11350 338299608 VRL11 216563 446868739 VRL110 23448 664409576 VRL111 11575 339039157 VRL112 23149 661332617 VRL113 2048 61046862 VRL114 26122 664160460 VRL115 2174 64764995 VRL116 22327 664086068 VRL117 23317 666255776 VRL118 3659 109050930 VRL119 23180 665172380 VRL12 201744 666493106 VRL120 11590 335046137 VRL121 23008 664679711 VRL122 12228 338832059 VRL123 22591 664270966 VRL124 13692 405909769 VRL125 22387 665914600 VRL126 2482 73993039 VRL127 22703 667381501 VRL128 3394 101172342 VRL129 22628 661840989 VRL13 64782 155179108 VRL130 4656 137549576 VRL131 22904 673803092 VRL132 4083 119637084 VRL133 22879 662991979 VRL134 5551 165320293 VRL135 23148 664999694 VRL136 5819 171775000 VRL137 22673 668542528 VRL138 7849 231600738 VRL139 22871 663327809 VRL14 212107 526211417 VRL140 4238 120052508 VRL141 28861 669032717 VRL142 3746 111460380 VRL143 22891 664361220 VRL144 2509 73351678 VRL145 24552 664240287 VRL146 9762 251362612 VRL147 22702 660801592 VRL148 7250 203163134 VRL149 36328 650622377 VRL15 231504 510332536 VRL150 7719 221201008 VRL151 22388 661482637 VRL152 13163 287131435 VRL153 24412 662422103 VRL154 3082 83056403 VRL155 22771 661222738 VRL156 6828 200274547 VRL157 22489 661890907 VRL158 3424 98648510 VRL159 22671 664240162 VRL16 192669 552943831 VRL160 5495 160014237 VRL161 22762 662463834 VRL162 10496 288267786 VRL163 24386 659952216 VRL164 7386 219192736 VRL165 23092 661622542 VRL166 7565 220521556 VRL167 25220 662310155 VRL168 4939 123779990 VRL169 23251 663395448 VRL17 21400 139451107 VRL170 4539 115826637 VRL171 24300 663419155 VRL172 3563 104712982 VRL173 25788 661101279 VRL174 4589 133546685 VRL175 24491 669736945 VRL176 3674 98938219 VRL177 24351 665637579 VRL178 2685 72430400 VRL179 24069 667426005 VRL18 73937 643896996 VRL180 3512 103654952 VRL181 24667 666306851 VRL182 6944 203160225 VRL183 23810 668006965 VRL184 6812 184506286 VRL185 23296 668363688 VRL186 2852 84712584 VRL187 24187 665094210 VRL188 3922 107724361 VRL189 23339 665176538 VRL19 11407 129107876 VRL190 3280 93669315 VRL191 27330 659200052 VRL192 6944 178729503 VRL193 23992 667076935 VRL194 4728 132417861 VRL195 22723 661214812 VRL196 5850 167602381 VRL197 27182 660103618 VRL198 9720 274841774 VRL199 24051 670232794 VRL2 17631 234354529 VRL20 61362 650031595 VRL200 3172 93782526 VRL201 23530 664001771 VRL202 23608 623469228 VRL203 25193 666754935 VRL204 4549 123588514 VRL205 24867 661166335 VRL206 2488 73964907 VRL207 25598 664144974 VRL208 6263 169704624 VRL209 25718 667634849 VRL21 10666 157039990 VRL210 14249 347056515 VRL211 26412 664860050 VRL212 4115 122105870 VRL213 23738 668811682 VRL214 5337 150667363 VRL215 26323 660701067 VRL216 4632 125077545 VRL217 26498 661122407 VRL218 6435 126429604 VRL219 27192 658251995 VRL22 35249 659745762 VRL220 7396 202846491 VRL221 23997 663152115 VRL222 8467 205721477 VRL223 25467 664387219 VRL224 23095 665471073 VRL225 3583 105451757 VRL226 30162 663743221 VRL227 12573 337105674 VRL228 23987 665681145 VRL229 4163 123851428 VRL23 5845 129302223 VRL230 23546 669066689 VRL231 2557 86055576 VRL232 24310 666823566 VRL233 3764 99778178 VRL234 24996 667498705 VRL235 2799 110004708 VRL236 23811 670211616 VRL237 13151 374757527 VRL238 29069 658082926 VRL239 18565 368364856 VRL24 27312 665721536 VRL240 26790 667893210 VRL241 16523 414468305 VRL242 31781 659141754 VRL243 5331 139241702 VRL244 25384 668647837 VRL245 5839 157123144 VRL246 31228 660268348 VRL247 11860 301542138 VRL248 25992 659732017 VRL249 3388 100932101 VRL25 13884 308196854 VRL250 24182 666450464 VRL251 6056 138648401 VRL252 29131 660984679 VRL253 3542 98178735 VRL254 35937 652249203 VRL255 5388 89576759 VRL256 24820 665712294 VRL257 2716 76867684 VRL258 28058 662477137 VRL259 3172 94020244 VRL26 32776 659460329 VRL260 27513 669104309 VRL261 2232 145519660 VRL262 24827 673537770 VRL263 7664 169185116 VRL264 25321 664486320 VRL265 3146 88780507 VRL266 40824 653578410 VRL267 10205 185232187 VRL268 32623 666347937 VRL269 16826 225289123 VRL27 14107 301524080 VRL270 26017 667169525 VRL271 2841 83899097 VRL272 46895 656030613 VRL273 11840 181982590 VRL274 34139 666316905 VRL275 10559 229488301 VRL276 34154 667549164 VRL277 11193 269051448 VRL278 22342 665926509 VRL279 2213 63674476 VRL28 24771 661733446 VRL280 34196 668567394 VRL281 5469 94606009 VRL282 28397 664772240 VRL283 4028 87504621 VRL284 36876 660160913 VRL285 2815 70883257 VRL286 39022 662192710 VRL287 5890 83131988 VRL288 25709 668361267 VRL289 13676 309872864 VRL29 20908 281282381 VRL290 12227 365289108 VRL291 18622 556401819 VRL292 1904 56895892 VRL293 37600 1122562705 VRL294 6408 191001999 VRL295 38039 1133916160 VRL296 7081 211211275 VRL297 37759 1126417186 VRL298 4393 131120156 VRL299 37573 1121004282 VRL3 271538 434737633 VRL30 23746 661358843 VRL300 3678 109876644 VRL301 37263 1113069284 VRL302 6459 192949404 VRL303 37152 1110095569 VRL304 3508 104849697 VRL305 37050 1109816359 VRL306 2971 88793839 VRL307 3626 108345075 VRL308 37059 1106189870 VRL309 3080 92054761 VRL31 6587 182464490 VRL310 37003 1105752003 VRL311 11640 347894626 VRL312 37117 1107776127 VRL313 3565 106560617 VRL314 37101 1107706020 VRL315 8906 266186263 VRL316 37266 1112961387 VRL317 19262 575377200 VRL318 37096 1108446363 VRL319 13825 412904674 VRL32 24944 660257958 VRL320 36984 1105279601 VRL321 9990 298572291 VRL322 37050 1107279362 VRL323 8845 264320349 VRL324 37064 1107692833 VRL325 6116 182789958 VRL326 36189 1081600686 VRL327 7777 232438502 VRL328 36975 1104659436 VRL329 7120 212797569 VRL33 6094 160643526 VRL330 36968 1104523842 VRL331 7152 213351330 VRL332 37490 1118859789 VRL333 7207 215280046 VRL334 37076 1107334502 VRL335 7143 213477342 VRL336 37102 1107707586 VRL337 6910 206517986 VRL338 36982 1105546560 VRL339 15953 475986831 VRL34 29620 659050873 VRL340 37101 1108822824 VRL341 14316 427808954 VRL342 37334 1114025091 VRL343 14994 447344151 VRL344 37333 1114773948 VRL345 2938 87808607 VRL346 36929 1103098613 VRL347 3203 95653246 VRL348 37305 1113491932 VRL349 3215 96002981 VRL35 5227 145555528 VRL350 37288 1113064958 VRL351 16286 486144130 VRL352 37084 1107504618 VRL353 6424 191904149 VRL354 37076 1107432971 VRL355 20302 605934045 VRL356 37031 1105952216 VRL357 9832 293761710 VRL358 36863 1101228020 VRL359 37008 1104966084 VRL36 22974 665203149 VRL360 3180 94878679 VRL361 37256 1111474329 VRL362 36493 1089874613 VRL363 36961 1104073846 VRL364 22011 657495345 VRL365 37040 1106411997 VRL366 14424 430928209 VRL367 37512 1115966636 VRL368 32908 983056718 VRL369 37272 1113460437 VRL37 810 20017439 VRL370 21437 640266041 VRL371 37031 1105934353 VRL372 12962 387102364 VRL373 37130 1108723285 VRL374 12932 386175225 VRL375 36661 1094921729 VRL376 13350 398759112 VRL377 37127 1108347763 VRL378 12643 377434462 VRL379 37089 1107210769 VRL38 23653 664319814 VRL380 6009 179371181 VRL381 37135 1108608927 VRL382 13706 409227550 VRL383 37191 1109653846 VRL384 14124 420580642 VRL385 37487 1119207298 VRL386 4769 142428949 VRL387 37392 1116764909 VRL388 4696 140298925 VRL389 37117 1108332871 VRL39 3113 82392829 VRL390 4890 146149213 VRL391 36462 1088391604 VRL392 5358 159900353 VRL393 36324 1083869001 VRL394 5527 164048842 VRL395 37683 1121763094 VRL396 4884 145039704 VRL397 37843 1127535366 VRL398 4948 147671027 VRL399 37836 1126567483 VRL4 204160 233127006 VRL40 25118 663967751 VRL400 30530 908724895 VRL401 37853 1126033212 VRL402 9402 280228621 VRL403 37824 1127171611 VRL404 2984 88807861 VRL405 37488 1117304491 VRL406 7726 230243891 VRL407 37941 1129305563 VRL408 37532 1120445998 VRL409 1997 59668580 VRL41 3558 86379552 VRL410 37597 1124750543 VRL411 7196 214942299 VRL412 36501 1085327765 VRL413 17277 515643148 VRL414 37644 1124295123 VRL415 16185 483323509 VRL416 37607 1123409112 VRL417 25114 750053377 VRL418 37125 1108729574 VRL419 10553 315107198 VRL42 26194 663182503 VRL420 37302 1115666751 VRL421 4990 149019167 VRL422 36729 1102119676 VRL423 4057 115151724 VRL424 38007 1099550726 VRL425 22700 657113389 VRL426 36233 1080568498 VRL427 20238 604653619 VRL428 36126 1079468132 VRL429 6493 194076254 VRL43 4328 101944484 VRL430 36442 1089136069 VRL431 3660 109381809 VRL432 36355 1085843904 VRL433 36149 1079760964 VRL434 2736 81726358 VRL435 36514 1090498832 VRL436 36471 1088861655 VRL437 2690 80317374 VRL438 36498 1089640784 VRL439 36485 1089316635 VRL44 29984 666877316 VRL440 4058 121149887 VRL441 36480 1089187037 VRL442 20291 605840055 VRL443 36692 1094502133 VRL444 20044 597880417 VRL445 37103 1105397042 VRL446 24055 717589519 VRL447 37470 1114694532 VRL448 13938 413639342 VRL449 38145 1132689212 VRL45 3451 91141747 VRL450 3923 116515899 VRL451 38113 1131951323 VRL452 8619 255935606 VRL453 38110 1131479978 VRL454 6988 207482376 VRL455 38120 1132052489 VRL456 11014 327172908 VRL457 38163 1132954792 VRL458 16013 428292237 VRL459 36504 1089824880 VRL46 30882 661771962 VRL460 14633 436963840 VRL461 36465 1089798277 VRL462 9067 270816317 VRL463 36634 1094347090 VRL464 16099 480946357 VRL465 36585 1092939862 VRL466 26936 804680772 VRL467 36579 1092745835 VRL468 19701 588548265 VRL469 36409 1087850765 VRL47 3927 112530241 VRL470 7691 229888754 VRL471 36081 1076074075 VRL472 28426 846960086 VRL473 36019 1068363395 VRL474 4444 132299980 VRL475 36633 1089995904 VRL476 23595 696576942 VRL477 37531 1120499182 VRL478 19177 572789700 VRL479 36329 1085562659 VRL48 24802 665944663 VRL480 26285 785357524 VRL481 35888 1072345405 VRL482 4109 122793098 VRL483 39032 1088756013 VRL484 4213 123289782 VRL485 39151 1092596317 VRL486 21876 606114024 VRL487 27208 668339779 VRL488 6782 180361510 VRL489 25964 671616295 VRL49 8275 198201474 VRL490 4268 120925526 VRL491 28113 669243590 VRL492 3041 62167235 VRL493 43669 655198029 VRL494 5435 69370841 VRL495 47375 649420172 VRL496 9074 65241280 VRL497 26227 670525319 VRL498 13735 66657146 VRL499 61633 639399229 VRL5 280540 596133023 VRL50 23424 665657614 VRL500 40583 121682196 VRL51 2191 65297472 VRL52 26410 663489762 VRL53 7941 227472348 VRL54 23414 659312050 VRL55 3877 115050329 VRL56 23459 666498757 VRL57 7604 224410146 VRL58 24455 660244246 VRL59 12870 379798658 VRL6 23485 82588249 VRL60 37083 1108550266 VRL61 30424 909649509 VRL62 37114 1109250740 VRL63 8058 240802925 VRL64 37139 1109667181 VRL65 5932 176025665 VRL66 23342 665139591 VRL67 2947 83685526 VRL68 23434 666365700 VRL69 13040 336264336 VRL7 253022 337221008 VRL70 22381 659575407 VRL71 3638 104774809 VRL72 23042 660595591 VRL73 11913 342221608 VRL74 22812 660547330 VRL75 11733 323111289 VRL76 22415 662597999 VRL77 5272 151310692 VRL78 22659 662437788 VRL79 1998 59113996 VRL8 248767 410111496 VRL80 22836 664299533 VRL81 2347 68539361 VRL82 23853 668562404 VRL83 7629 218240519 VRL84 22604 662478335 VRL85 8047 225950637 VRL86 22724 664920515 VRL87 2635 78589590 VRL88 22494 660735890 VRL89 11922 342043890 VRL9 237501 450889113 VRL90 24307 666168961 VRL91 11967 342780598 VRL92 23312 667704534 VRL93 14252 363117989 VRL94 24206 666022023 VRL95 11654 345441201 VRL96 24197 667442447 VRL97 12113 342896632 VRL98 22579 662522993 VRL99 12505 349482081 VRT1 151992 879089965 VRT10 1171 26255719 VRT100 226 1172298670 VRT101 6 287514912 VRT102 21 1147858523 VRT103 8 396461523 VRT104 20 1173136487 VRT105 40 408449657 VRT106 21 1168748140 VRT107 6 417779009 VRT108 18 1151861742 VRT109 8 407907477 VRT11 293 13983146 VRT110 23 1107646329 VRT111 13 713326122 VRT112 23 1144234985 VRT113 9 420614896 VRT114 134 1180161953 VRT115 79 1025790260 VRT116 1 843366180 VRT117 1 842558404 VRT118 1 707956555 VRT119 1 635713434 VRT12 62 1165207373 VRT120 2 1006930617 VRT121 6 953838719 VRT122 1 690654357 VRT123 2 1036857559 VRT124 1 481763206 VRT125 4 1057207450 VRT126 35 773383371 VRT127 4329 1156513083 VRT128 16002 459253055 VRT129 420832 391734084 VRT13 11 316368323 VRT130 7800 9038790 VRT131 384549 422711122 VRT132 57741 115644000 VRT133 67 1170083182 VRT134 5 206181523 VRT135 47 1183370565 VRT136 7 243122995 VRT137 23 1181318093 VRT138 23 251314286 VRT139 405 1094560939 VRT14 42 1131640503 VRT140 4 347682430 VRT141 54 1154458892 VRT142 10 313635714 VRT143 43 1146391866 VRT144 5 240249405 VRT145 31 1184009833 VRT146 15 299492187 VRT147 28 1054983542 VRT148 13 348062730 VRT149 94 852284325 VRT15 51 1151263002 VRT150 2 696540660 VRT151 4 904864528 VRT152 33 731071093 VRT153 37 1164742986 VRT154 36 528124428 VRT155 37 1123854199 VRT156 9 481951495 VRT157 156 1183779024 VRT158 6 312654085 VRT159 1589 1155278298 VRT16 1 25018904 VRT160 64 1040389365 VRT161 5 1114313003 VRT162 20 655696990 VRT163 32 1165038142 VRT164 10 359729387 VRT165 37 977985462 VRT166 3 346034432 VRT167 12 843150289 VRT168 91 688705431 VRT169 43 1161336176 VRT17 21 1144265373 VRT170 12 337935768 VRT171 33 1177732884 VRT172 10 315490636 VRT173 29 1133415830 VRT174 19 985076759 VRT175 13 1094615957 VRT176 1 168556870 VRT177 302 1175670063 VRT178 22 599394507 VRT179 42 1159071038 VRT18 11 861785425 VRT180 12 363275175 VRT181 38 1157829262 VRT182 17 1062116002 VRT183 43 1173707836 VRT184 29 886034587 VRT185 55 1165077059 VRT186 8 313502651 VRT187 30 1158773265 VRT188 18 307245863 VRT189 11 1125864671 VRT19 37 1039301283 VRT190 6 320509967 VRT191 37 1160120295 VRT192 11 302784051 VRT193 26 986334395 VRT194 4 443026194 VRT195 53 1177747146 VRT196 16 515509915 VRT197 24 1145214277 VRT198 20 842461686 VRT199 39 1152236201 VRT2 3 141387178 VRT20 2 394160013 VRT200 5 287434963 VRT201 28 1173216529 VRT202 19 516043856 VRT203 30 1178674121 VRT204 19 723703127 VRT205 44 1152763700 VRT206 13 540214668 VRT207 17 1143715445 VRT208 18 1174563204 VRT209 16 342884613 VRT21 30 1168492153 VRT210 27 1175110025 VRT211 23 1166697769 VRT212 8 219831677 VRT213 48 1160289310 VRT214 18 759308542 VRT215 23 1171047943 VRT216 10 534818626 VRT217 36 1182736379 VRT218 16 567153184 VRT219 28 1134330417 VRT22 29 742092719 VRT220 303 755315061 VRT221 38 1165356567 VRT222 8 214956194 VRT223 51 1172310789 VRT224 31 991676973 VRT225 2 484884812 VRT226 6 1101564199 VRT227 5 549920900 VRT228 21 1018602957 VRT229 1 218912229 VRT23 30 1174531068 VRT230 38 1176533902 VRT231 7 517093999 VRT232 20 1141381288 VRT233 16 736377496 VRT234 15 1167658288 VRT235 26 287064166 VRT236 37 1177840384 VRT237 14 728760872 VRT238 40 1171007353 VRT239 2 181314551 VRT24 40 778567113 VRT240 43 1178099053 VRT241 11 1013144776 VRT242 6 1099894888 VRT243 4 531276777 VRT244 13 1174401695 VRT245 6 321859036 VRT246 22 1163106414 VRT247 34 516457854 VRT248 31 1159946079 VRT249 29 737532156 VRT25 147 10842596 VRT250 150 1081754494 VRT251 19 1093025330 VRT252 6 295537066 VRT253 43 1171949486 VRT254 37 796605274 VRT255 40 1107875829 VRT256 15 1063299345 VRT257 13 1138287802 VRT258 16 1105290063 VRT259 15 1130244137 VRT26 586 15797052 VRT260 15 1036912531 VRT261 41 1159354291 VRT262 35304 1103421015 VRT27 2343 67436863 VRT28 231773 799599927 VRT29 18385 13493823 VRT3 31 1168751005 VRT30 201992 813214419 VRT31 31 452289725 VRT32 196759 156490806 VRT33 335335 229992764 VRT34 176839 120754439 VRT35 133023 105741590 VRT36 298628 205468986 VRT37 291757 181465675 VRT38 327268 606042895 VRT39 95677 1060886498 VRT4 30955 1101865239 VRT40 145106 21008965 VRT41 75789 25336814 VRT42 13711 1164642593 VRT43 6492 595515114 VRT44 6958 1164949634 VRT45 18 646516563 VRT46 48 1183553258 VRT47 227 233550951 VRT48 39 902622871 VRT49 3 1023379555 VRT5 74952 70629379 VRT50 2 589523540 VRT51 6 1150383114 VRT52 2 310907973 VRT53 24 1179751921 VRT54 13 344051702 VRT55 43 1172808323 VRT56 20 319354703 VRT57 1 839681426 VRT58 1 825560060 VRT59 2 1082779519 VRT6 37396 74041240 VRT60 2 758561446 VRT61 6 1178831395 VRT62 19 1164471784 VRT63 1 46063367 VRT64 22 1169870462 VRT65 332 504305975 VRT66 49 1183118178 VRT67 3 26813209 VRT68 1 772932187 VRT69 1 662004353 VRT7 18698 27611025 VRT70 2 911653698 VRT71 1 364230008 VRT72 4 1133578097 VRT73 493 875502265 VRT74 28 1159189661 VRT75 1 81199652 VRT76 27 1178866037 VRT77 2 65038611 VRT78 24 1169138155 VRT79 4 106598356 VRT8 9349 597580446 VRT80 29 755437537 VRT81 41 289507176 VRT82 35 926559538 VRT83 2 1080114977 VRT84 3 1012738546 VRT85 2 458353277 VRT86 11 1181336336 VRT87 462 807789205 VRT88 10 1126531868 VRT89 3 244017515 VRT9 4685 4674270 VRT90 624 928535178 VRT91 1 313568160 VRT92 4 1044936093 VRT93 3 637611209 VRT94 6 1049980901 VRT95 3 425844009 VRT96 38 1127532336 VRT97 6 357716939 VRT98 23 1143934087 VRT99 18 187861254 2.2.7 Selected Per-Organism Statistics The following table provides the number of entries and bases of DNA/RNA for the twenty most sequenced organisms in Release 261.0, excluding chloroplast and mitochondrial sequences, metagenomic sequences, Whole Genome Shotgun sequences, 'constructed' CON-division sequences, synthetic construct sequences, uncultured sequences, Transcriptome Shotgun Assembly sequences, and Targeted Locus Study sequences: Entries Bases Species 8849611 263280740770 Severe acute respiratory syndrome coronavirus 2 1943950 255975379562 Triticum aestivum 111961 205666444201 Hordeum vulgare 1347585 126087260773 Hordeum vulgare subsp. vulgare 520 106587373982 Hordeum bulbosum 164 93011095388 Viscum album 29876 92980158773 Hordeum vulgare subsp. spontaneum 10049258 43637339408 Mus musculus 27810338 36825525087 Homo sapiens 175081 24021381303 Escherichia coli 29811 21128005736 Avena sativa 2640663 20263158983 Arabidopsis thaliana 33665 16333452591 Klebsiella pneumoniae 2243780 16210185539 Bos taurus 1732296 13758456861 Danio rerio 312035 13104402122 Arachis hypogaea 195 11554711366 Sambucus nigra 28766 11286173222 Vicia faba 14812 10342955730 Triticum monococcum 23130 9981582961 Triticum turgidum subsp. durum 2.2.8 Growth of GenBank The following table lists the number of bases and the number of sequence records in each release of GenBank, beginning with Release 3 in 1982. CON-division records are not represented in these statistics: because they are constructed from the non-CON records in the database, their inclusion here would be a form of double-counting. Also note that this table is limited to 'traditional', non-set-based (WGS/TSA/TLS) GenBank records. From 1982 to the present, the number of bases in GenBank has doubled approximately every 18 months. Release Date Base Pairs Entries 3 Dec 1982 680338 606 14 Nov 1983 2274029 2427 20 May 1984 3002088 3665 24 Sep 1984 3323270 4135 25 Oct 1984 3368765 4175 26 Nov 1984 3689752 4393 32 May 1985 4211931 4954 36 Sep 1985 5204420 5700 40 Feb 1986 5925429 6642 42 May 1986 6765476 7416 44 Aug 1986 8442357 8823 46 Nov 1986 9615371 9978 48 Feb 1987 10961380 10913 50 May 1987 13048473 12534 52 Aug 1987 14855145 14020 53 Sep 1987 15514776 14584 54 Dec 1987 16752872 15465 55 Mar 1988 19156002 17047 56 Jun 1988 20795279 18226 57 Sep 1988 22019698 19044 57.1 Oct 1988 23800000 20579 58 Dec 1988 24690876 21248 59 Mar 1989 26382491 22479 60 Jun 1989 31808784 26317 61 Sep 1989 34762585 28791 62 Dec 1989 37183950 31229 63 Mar 1990 40127752 33377 64 Jun 1990 42495893 35100 65 Sep 1990 49179285 39533 66 Dec 1990 51306092 41057 67 Mar 1991 55169276 43903 68 Jun 1991 65868799 51418 69 Sep 1991 71947426 55627 70 Dec 1991 77337678 58952 71 Mar 1992 83894652 65100 72 Jun 1992 92160761 71280 73 Sep 1992 101008486 78608 74 Dec 1992 120242234 97084 75 Feb 1993 126212259 106684 76 Apr 1993 129968355 111911 77 Jun 1993 138904393 120134 78 Aug 1993 147215633 131328 79 Oct 1993 157152442 143492 80 Dec 1993 163802597 150744 81 Feb 1994 173261500 162946 82 Apr 1994 180589455 169896 83 Jun 1994 191393939 182753 84 Aug 1994 201815802 196703 85 Oct 1994 217102462 215273 86 Dec 1994 230485928 237775 87 Feb 1995 248499214 269478 88 Apr 1995 286094556 352414 89 Jun 1995 318624568 425211 90 Aug 1995 353713490 492483 91 Oct 1995 384939485 555694 92 Dec 1995 425860958 620765 93 Feb 1996 463758833 685693 94 Apr 1996 499127741 744295 95 Jun 1996 551750920 835487 96 Aug 1996 602072354 920588 97 Oct 1996 651972984 1021211 98 Dec 1996 730552938 1114581 99 Feb 1997 786898138 1192505 100 Apr 1997 842864309 1274747 101 Jun 1997 966993087 1491069 102 Aug 1997 1053474516 1610848 103 Oct 1997 1160300687 1765847 104 Dec 1997 1258290513 1891953 105 Feb 1998 1372368913 2042325 106 Apr 1998 1502542306 2209232 107 Jun 1998 1622041465 2355928 108 Aug 1998 1797137713 2532359 109 Oct 1998 2008761784 2837897 110 Dec 1998 2162067871 3043729 111 Apr 1999 2569578208 3525418 112 Jun 1999 2974791993 4028171 113 Aug 1999 3400237391 4610118 114 Oct 1999 3841163011 4864570 115 Dec 1999 4653932745 5354511 116 Feb 2000 5805414935 5691170 117 Apr 2000 7376080723 6215002 118 Jun 2000 8604221980 7077491 119 Aug 2000 9545724824 8214339 120 Oct 2000 10335692655 9102634 121 Dec 2000 11101066288 10106023 122 Feb 2001 11720120326 10896781 123 Apr 2001 12418544023 11545572 124 Jun 2001 12973707065 12243766 125 Aug 2001 13543364296 12813516 126 Oct 2001 14396883064 13602262 127 Dec 2001 15849921438 14976310 128 Feb 2002 17089143893 15465325 129 Apr 2002 19072679701 16769983 130 Jun 2002 20648748345 17471130 131 Aug 2002 22616937182 18197119 132 Oct 2002 26525934656 19808101 133 Dec 2002 28507990166 22318883 134 Feb 2003 29358082791 23035823 135 Apr 2003 31099264455 24027936 136 Jun 2003 32528249295 25592865 137 Aug 2003 33865022251 27213748 138 Oct 2003 35599621471 29819397 139 Dec 2003 36553368485 30968418 140 Feb 2004 37893844733 32549400 141 Apr 2004 38989342565 33676218 142 Jun 2004 40325321348 35532003 143 Aug 2004 41808045653 37343937 144 Oct 2004 43194602655 38941263 145 Dec 2004 44575745176 40604319 146 Feb 2005 46849831226 42734478 147 Apr 2005 48235738567 44202133 148 Jun 2005 49398852122 45236251 149 Aug 2005 51674486881 46947388 150 Oct 2005 53655236500 49152445 151 Dec 2005 56037734462 52016762 152 Feb 2006 59750386305 54584635 153 Apr 2006 61582143971 56620500 154 Jun 2006 63412609711 58890345 155 Aug 2006 65369091950 61132599 156 Oct 2006 66925938907 62765195 157 Dec 2006 69019290705 64893747 158 Feb 2007 71292211453 67218344 159 Apr 2007 75742041056 71802595 160 Jun 2007 77248690945 73078143 161 Aug 2007 79525559650 76146236 162 Oct 2007 81563399765 77632813 163 Dec 2007 83874179730 80388382 164 Feb 2008 85759586764 82853685 165 Apr 2008 89172350468 85500730 166 Jun 2008 92008611867 88554578 167 Aug 2008 95033791652 92748599 168 Oct 2008 97381682336 96400790 169 Dec 2008 99116431942 98868465 170 Feb 2009 101467270308 101815678 171 Apr 2009 102980268709 103335421 172 Jun 2009 105277306080 106073709 173 Aug 2009 106533156756 108431692 174 Oct 2009 108560236506 110946879 175 Dec 2009 110118557163 112910950 176 Feb 2010 112326229652 116461672 177 Apr 2010 114348888771 119112251 178 Jun 2010 115624497715 120604423 179 Aug 2010 117476523128 122941883 180 Oct 2010 118551641086 125764384 181 Dec 2010 122082812719 129902276 182 Feb 2011 124277818310 132015054 183 Apr 2011 126551501141 135440924 184 Jun 2011 129178292958 140482268 185 Aug 2011 130671233801 142284608 186 Oct 2011 132067413372 144458648 187 Dec 2011 135117731375 146413798 188 Feb 2012 137384889783 149819246 189 Apr 2012 139266481398 151824421 190 Jun 2012 141343240755 154130210 191 Aug 2012 143081765233 156424033 192 Oct 2012 145430961262 157889737 193 Dec 2012 148390863904 161140325 194 Feb 2013 150141354858 162886727 195 Apr 2013 151178979155 164136731 196 Jun 2013 152599230112 165740164 197 Aug 2013 154192921011 167295840 198 Oct 2013 155176494699 168335396 199 Dec 2013 156230531562 169331407 200 Feb 2014 157943793171 171123749 201 Apr 2014 159813411760 171744486 202 Jun 2014 161822845643 173353076 203 Aug 2014 165722980375 174108750 204 Oct 2014 181563676918 178322253 205 Dec 2014 184938063614 179295769 206 Feb 2015 187893826750 181336445 207 Apr 2015 189739230107 182188746 208 Jun 2015 193921042946 185019352 209 Aug 2015 199823644287 187066846 210 Oct 2015 202237081559 188372017 211 Dec 2015 203939111071 189232925 212 Feb 2016 207018196067 190250235 213 Apr 2016 211423912047 193739511 214 Jun 2016 213200907819 194463572 215 Aug 2016 217971437647 196120831 216 Oct 2016 220731315250 197390691 217 Dec 2016 224973060433 198565475 218 Feb 2017 228719437638 199341377 219 Apr 2017 231824951552 200877884 220 Jun 2017 234997362623 201663568 221 Aug 2017 240343378258 203180606 222 Oct 2017 244914705468 203953682 223 Dec 2017 249722163594 206293625 224 Feb 2018 253630708098 207040555 225 Apr 2018 260189141631 208452303 226 Jun 2018 263957884539 209775348 227 Aug 2018 260806936411 208831050 (Section 1.3.1 of GB 227.0 release notes explains decrease) 228 Oct 2018 279668290132 209656636 229 Dec 2018 285688542186 211281415 230 Feb 2019 303709510632 212260377 231 Apr 2019 321680566570 212775414 232 Jun 2019 329835282370 213383758 233 Aug 2019 366733917629 213865349 234 Oct 2019 386197018538 216763706 235 Dec 2019 388417258009 215333020 (Section 1.3.2 of GB 235.0 release notes explains decrease) 236 Feb 2020 399376854872 216214215 237 Apr 2020 415770027949 216531829 238 Jun 2020 427823258901 217122233 239 Aug 2020 654057069549 218642238 240 Oct 2020 698688094046 219055207 241 Dec 2020 723003822007 221467827 242 Feb 2021 776291211106 226241476 243 Apr 2021 832400799511 227123201 244 Jun 2021 866009790959 227888889 245 Aug 2021 940513260726 231982592 246 Oct 2021 1014763752113 233642893 247 Dec 2021 1053275115030 234557297 248 Feb 2022 1173984081721 236338284 249 Apr 2022 1266154890918 237520318 250 Jun 2022 1395628631187 239017893 251 Aug 2022 1492800704497 239915786 252 Oct 2022 1562963366851 240539282 253 Dec 2022 1635594138493 241015745 254 Feb 2023 1731302248418 241830635 255 Apr 2023 1826746318813 242554936 256 Jun 2023 1966479976146 243560863 257 Aug 2023 2112058517945 246119175 258 Oct 2023 2433391164875 247777761 259 Dec 2023 2570711588044 249060436 n/a Feb 2024 n/a n/a No GenBank Release delivered in Feb 2024 260 Apr 2024 3213818003787 250803006 261 Jun 2024 3387240663231 251094334 The following table lists the number of bases and the number of sequence records for WGS sequences processed at GenBank, beginning with Release 129.0 in April of 2002. Please note that WGS data are not distributed in conjunction with GenBank releases. Rather, per-project data files are continuously available in the WGS areas of the NCBI FTP site: ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs ftp://ftp.ncbi.nih.gov/genbank/wgs Release Date Base Pairs Entries 129 Apr 2002 692266338 172768 130 Jun 2002 3267608441 397502 131 Aug 2002 3848375582 427771 132 Oct 2002 3892435593 434224 133 Dec 2002 6702372564 597042 134 Feb 2003 6705740844 597345 135 Apr 2003 6897080355 596818 136 Jun 2003 6992663962 607155 137 Aug 2003 7144761762 593801 138 Oct 2003 8662242833 1683437 139 Dec 2003 14523454868 2547094 140 Feb 2004 22804145885 3188754 141 Apr 2004 24758556215 4112532 142 Jun 2004 25592758366 4353890 143 Aug 2004 28128611847 4427773 144 Oct 2004 30871590379 5285276 145 Dec 2004 35009256228 5410415 146 Feb 2005 38076300084 6111782 147 Apr 2005 39523208346 6685746 148 Jun 2005 46767232565 8711924 149 Aug 2005 53346605784 10276161 150 Oct 2005 56162807647 11169448 151 Dec 2005 59638900034 12088491 152 Feb 2006 63183065091 12465546 153 Apr 2006 67488612571 13573144 154 Jun 2006 78858635822 17733973 155 Aug 2006 80369977826 17960667 156 Oct 2006 81127502509 18500772 157 Dec 2006 81611376856 18540918 158 Feb 2007 86043478524 19421576 159 Apr 2007 93022691867 23446831 160 Jun 2007 97102606459 23718400 161 Aug 2007 101964323738 25384475 162 Oct 2007 102003045298 25354041 163 Dec 2007 106505691578 26177471 164 Feb 2008 108635736141 27439206 165 Apr 2008 110500961400 26931049 166 Jun 2008 113639291344 39163548 167 Aug 2008 118593509342 40214247 168 Oct 2008 136085973423 46108952 169 Dec 2008 141374971004 48394838 170 Feb 2009 143797800446 49036947 171 Apr 2009 144522542010 48948309 172 Jun 2009 145959997864 49063546 173 Aug 2009 148165117763 48443067 174 Oct 2009 149348923035 48119301 175 Dec 2009 158317168385 54076973 176 Feb 2010 163991858015 57134273 177 Apr 2010 165536009514 58361599 178 Jun 2010 167725292032 58592700 179 Aug 2010 169253846128 58994334 180 Oct 2010 175339059129 59397637 181 Dec 2010 177385297156 59608311 182 Feb 2011 190034462797 62349795 183 Apr 2011 191401393188 62715288 184 Jun 2011 200487078184 63735078 185 Aug 2011 208315831132 64997137 186 Oct 2011 218666368056 68330215 187 Dec 2011 239868309609 73729553 188 Feb 2012 261370512675 78656704 189 Apr 2012 272693351548 80905298 190 Jun 2012 287577367116 82076779 191 Aug 2012 308196411905 84020064 192 Oct 2012 333881846451 86480509 193 Dec 2012 356002922838 92767765 194 Feb 2013 390900990416 103101291 195 Apr 2013 418026593606 110509314 196 Jun 2013 453829752320 112488036 197 Aug 2013 500420412665 124812020 198 Oct 2013 535842167741 130203205 199 Dec 2013 556764321498 133818570 200 Feb 2014 591378698544 139725795 201 Apr 2014 621015432437 143446790 202 Jun 2014 719581958743 175779064 203 Aug 2014 774052098731 189080419 204 Oct 2014 805549167708 196049974 205 Dec 2014 848977922022 200301550 206 Feb 2015 873281414087 205465046 207 Apr 2015 969102906813 243779199 208 Jun 2015 1038937210221 258702138 209 Aug 2015 1163275601001 302955543 210 Oct 2015 1222635267498 309198943 211 Dec 2015 1297865618365 317122157 212 Feb 2016 1399865495608 333012760 213 Apr 2016 1452207704949 338922537 214 Jun 2016 1556175944648 350278081 215 Aug 2016 1637224970324 359796497 216 Oct 2016 1676238489250 363213315 217 Dec 2016 1817189565845 395301176 218 Feb 2017 1892966308635 409490397 219 Apr 2017 2035032639807 451840147 220 Jun 2017 2164683993369 487891767 221 Aug 2017 2242294609510 499965722 222 Oct 2017 2318156361999 508825331 223 Dec 2017 2466098053327 551063065 224 Feb 2018 2608532210351 564286852 225 Apr 2018 2784740996536 621379029 226 Jun 2018 2944617324086 639804105 227 Aug 2018 3204855013281 665309765 228 Oct 2018 3444172142207 722438528 229 Dec 2018 3656719423096 773773190 230 Feb 2019 4164513961679 945019312 231 Apr 2019 4421986382065 993732214 232 Jun 2019 4847677297950 1022913321 233 Aug 2019 5585922333160 1075272215 234 Oct 2019 5985250251028 1097629174 235 Dec 2019 6277551200690 1127023870 236 Feb 2020 6968991265752 1206720688 237 Apr 2020 7788133221338 1267547429 238 Jun 2020 8114046262158 1302852615 239 Aug 2020 8841649410652 1408122887 240 Oct 2020 9215815569509 1432874252 241 Dec 2020 11830842428018 1517995689 242 Feb 2021 12270717209612 1563938043 243 Apr 2021 12732048052023 1590670459 244 Jun 2021 13442974346437 1632796606 245 Aug 2021 13888187863722 1653427055 246 Oct 2021 14599101574547 1721064101 247 Dec 2021 14922033922302 1734664952 248 Feb 2022 15428122140820 1750505007 249 Apr 2022 16071520702170 1781374217 250 Jun 2022 16710373006600 1796349114 251 Aug 2022 17511809676629 2024099677 252 Oct 2022 18231960808828 2167900306 253 Dec 2022 19086596616569 2241439349 254 Feb 2023 20116642176263 2337838461 255 Apr 2023 20926504760221 2440470464 256 Jun 2023 21791125594114 2611654455 257 Aug 2023 22294446104543 2631493489 258 Oct 2023 23600199887231 2775205599 259 Dec 2023 24651580464335 2863228552 n/a Feb 2024 n/a n/a No GenBank Release delivered in Feb 2024 260 Apr 2024 27225116587937 3333621823 261 Jun 2024 27900199328333 3380877515 The following table provides the number of bases and the number of sequence records for bulk-oriented Transcriptome Shotgun Assembly (TSA) RNA sequencing projects processed at GenBank, beginning with Release 190.0 in June of 2012. TSA sequences processed prior to Release 190.0 in June of 2012 were handled individually, and are present in the gbtsa*.seq files of GenBank releases (hence, they contribute to the statistics in the first table of this section). Subsequent to that date NCBI began processing TSA submissions using an approach that is analogous to the bulk-oriented approach used for WGS, assigning a TSA project code (for example: GAAA) to each TSA submission. Note 1 : Although we provide statistics for bulk-oriented TSA submissions as of the dates for GenBank releases, TSA files are not distributed or updated in conjunction with those releases. Rather, per-project TSA data files are continuously available in the TSA areas of the NCBI FTP site: ftp://ftp.ncbi.nih.gov/ncbi-asn1/tsa ftp://ftp.ncbi.nih.gov/genbank/tsa Note 2 : NCBI's partner institutions within the INSDC might still choose to treat TSA submissions as separate records, without a common TSA project code. In which case, they will not be included in this table. Note 3 : Statistics for bulk-oriented TSA projects originating at the European Nucleotide Archive of the INSDC were not included in this table until the October 2016 GenBank Release. Note 4 : This table is incomplete. Statistics for Releases 190.0 to 200.0 will be back-filled if time allows. Release Date Base Pairs Entries 201 Apr 2014 23632325832 29734989 202 Jun 2014 31707343431 38011942 203 Aug 2014 33676182560 40556905 204 Oct 2014 36279458440 43567759 205 Dec 2014 46056420903 62635617 206 Feb 2015 49765340047 66706014 207 Apr 2015 55796332435 71989588 208 Jun 2015 60697472570 76974601 209 Aug 2015 69360654413 87827013 210 Oct 2015 70917172944 81790031 211 Dec 2015 77583339176 87488539 212 Feb 2016 81932555094 92132318 213 Apr 2016 87811163676 98147566 214 Jun 2016 94413958919 104677061 215 Aug 2016 103399742586 113179607 216 Oct 2016 113209225762 124199597 217 Dec 2016 125328824508 142094337 218 Feb 2017 133517212104 151431485 219 Apr 2017 149038907599 165068542 220 Jun 2017 158112969073 176812130 221 Aug 2017 167045663417 186777106 222 Oct 2017 172909268535 192754804 223 Dec 2017 181394660188 201559502 224 Feb 2018 193940551226 214324264 225 Apr 2018 205232396043 227364990 226 Jun 2018 216556686631 238788334 227 Aug 2018 225520004678 249295386 228 Oct 2018 235875573598 259927414 229 Dec 2018 248592892188 274845473 230 Feb 2019 263936885705 294772430 231 Apr 2019 277118019688 311247136 232 Jun 2019 285390240861 319927264 233 Aug 2019 294727165179 331347807 234 Oct 2019 305371891408 342811151 235 Dec 2019 325433016129 367193844 236 Feb 2020 340994289065 386644871 237 Apr 2020 349692751528 396392280 238 Jun 2020 359947709062 409725050 239 Aug 2020 366968951160 417524567 240 Oct 2020 382996662270 435968379 241 Dec 2020 392206975386 446397378 242 Feb 2021 407605409948 463151000 243 Apr 2021 425076483459 481154920 244 Jun 2021 436594941165 494641358 245 Aug 2021 440578422611 498305045 246 Oct 2021 449891016597 508319391 247 Dec 2021 455870853358 514158576 248 Feb 2022 465013156502 524464601 249 Apr 2022 474421076448 534770586 250 Jun 2022 485056129761 546991572 251 Aug 2022 497501380386 560196830 252 Oct 2022 511476787957 574020080 253 Dec 2022 611850391049 649918843 254 Feb 2023 630615054587 672261981 255 Apr 2023 636291358227 678332682 256 Jun 2023 643127590034 683922756 257 Aug 2023 646176166908 686271945 258 Oct 2023 659924904311 701336089 259 Dec 2023 668807109326 715803123 n/a Feb 2024 n/a n/a No GenBank Release delivered in Feb 2024 260 Apr 2024 689648317082 741066498 261 Jun 2024 695405769319 746753803 The following table provides the number of bases and the number of sequence records for Targeted Locus Study (TLS) sequencing projects of special marker genes processed at GenBank, beginning with Release 217.0 in December of 2016. Note 1 : Although we provide statistics for bulk-oriented TLS submissions as of the dates for GenBank releases, TLS files are not distributed or updated in conjunction with those releases. Rather, per-project TLS data files are continuously available in the TLS areas of the NCBI FTP site: ftp://ftp.ncbi.nih.gov/ncbi-asn1/tls ftp://ftp.ncbi.nih.gov/genbank/tls Note 2 : NCBI's partner institutions within the INSDC might still choose to treat TLS submissions as separate records, without a common TLS project code. In which case, they will not be included in this table. Note 3 : This table is incomplete. Statistics for releases prior to 217.0 will be back-filled if time allows. Release Date Base Pairs Entries 217 Dec 2016 584697919 1268690 218 Feb 2017 636923295 1438349 219 Apr 2017 636923295 1438349 (unchanged) 220 Jun 2017 824191338 1628475 221 Aug 2017 824191338 1628475 (unchanged) 222 Oct 2017 2993818315 9479460 223 Dec 2017 4458042616 12695198 224 Feb 2018 4531966831 12819978 225 Apr 2018 5612769448 14782654 226 Jun 2018 5896511468 15393041 227 Aug 2018 6077824493 15822538 228 Oct 2018 8435112913 20752288 229 Dec 2018 8511829281 20924588 230 Feb 2019 9146836085 23259929 231 Apr 2019 9623321565 24240761 232 Jun 2019 10182427815 25530139 233 Aug 2019 10531800829 26363945 234 Oct 2019 10848455369 27460978 235 Dec 2019 11280596614 28227180 236 Feb 2020 13669678196 34037371 237 Apr 2020 24615270313 65521132 238 Jun 2020 27500635128 75063181 239 Aug 2020 27825059498 75682157 240 Oct 2020 28814798868 78177358 241 Dec 2020 33036509446 88039152 242 Feb 2021 33634122995 90130561 243 Apr 2021 37998534461 102395753 244 Jun 2021 38198113354 102662929 245 Aug 2021 39930167315 106995218 246 Oct 2021 40168874815 107569935 247 Dec 2021 41143480750 109379021 248 Feb 2022 41321107981 109809966 249 Apr 2022 41324192343 109820387 250 Jun 2022 41999358847 111142107 251 Aug 2022 43852280645 115103527 252 Oct 2022 43860512749 115123306 253 Dec 2022 44009657455 115552377 254 Feb 2023 46465508548 121067644 255 Apr 2023 46567924833 121186672 256 Jun 2023 47302831210 122798571 257 Aug 2023 48289699026 124421006 258 Oct 2023 50868407906 130654568 259 Dec 2023 51568356978 132355132 n/a Feb 2024 n/a n/a No GenBank Release delivered in Feb 2024 260 Apr 2024 53492243256 135115766 261 Jun 2024 54512778803 135446337 3. FILE FORMATS The flat file examples included in this section, while not always from the current release, are usually fairly recent. Any differences compared to the actual records are the result of updates to the entries involved. 3.1 File Header Information With the exception of the lists of new, changed, and deleted accession numbers, each of the files of a GenBank release begins with the same header, except for the first line, which contains the file name, and the sixth line, which contains the title of the file. The first line of the file contains the file name in character positions 1 to 9 and the full database name (Genetic Sequence Data Bank, aka 'GenBank') starting in column 22. The brief names of the files in this release are listed in Section 2.2. The second line contains the date of the current release in the form `day month year', beginning in position 27. The fourth line contains the current GenBank release number. The release number appears in positions 48 to 52 and consists of three numbers separated by a decimal point. The number to the left of the decimal is the major release number. The digit to the right of the decimal indicates the version of the major release; it is zero for the first version. The sixth line contains a title for the file. The eighth line lists the number of entries (loci), number of bases (or base pairs), and number of reports of sequences (equal to number of entries in this case). These numbers are right-justified at fixed positions. The number of entries appears in positions 1 to 8, the number of bases in positions 16 to 26, and the number of reports in positions 40 to 47. The third, fifth, seventh, and ninth lines are blank. 1 10 20 30 40 50 60 70 79 ---------+---------+---------+---------+---------+---------+---------+--------- GBBCT1.SEQ Genetic Sequence Data Bank June 15 2024 NCBI-GenBank Flat File Release 261.0 Bacterial Sequences (Part 1) 102016 loci, 184379131 bases, from 102016 reported sequences ---------+---------+---------+---------+---------+---------+---------+--------- 1 10 20 30 40 50 60 70 79 Example 1. Sample File Header 3.4 Sequence Entry Files GenBank releases contain one or more sequence entry data files, one for each "division" of GenBank. 3.4.1 File Organization Each of these files has the same format and consists of two parts: header information (described in section 3.1) and sequence entries for that division (described in the following sections). 3.4.2 Entry Organization In the second portion of a sequence entry file (containing the sequence entries for that division), each record (line) consists of two parts. The first part is found in positions 1 to 10 and may contain: 1. A keyword, beginning in column 1 of the record (e.g., REFERENCE is a keyword). 2. A subkeyword beginning in column 3, with columns 1 and 2 blank (e.g., AUTHORS is a subkeyword of REFERENCE). Or a subkeyword beginning in column 4, with columns 1, 2, and 3 blank (e.g., PUBMED is a subkeyword of REFERENCE). 3. Blank characters, indicating that this record is a continuation of the information under the keyword or subkeyword above it. 4. A code, beginning in column 6, indicating the nature of an entry (feature key) in the FEATURES table; these codes are described in Section 3.4.12.1 below. 5. A number, ending in column 9 of the record. This number occurs in the portion of the entry describing the actual nucleotide sequence and designates the numbering of sequence positions. 6. Two slashes (//) in positions 1 and 2, marking the end of an entry. The second part of each sequence entry record contains the information appropriate to its keyword, in positions 13 to 80 for keywords and positions 11 to 80 for the sequence. The following is a brief description of each entry field. Detailed information about each field may be found in Sections 3.4.4 to 3.4.15. LOCUS - A short mnemonic name for the entry, chosen to suggest the sequence's definition. Mandatory keyword/exactly one record. DEFINITION - A concise description of the sequence. Mandatory keyword/one or more records. ACCESSION - The primary accession number is a unique, unchanging identifier assigned to each GenBank sequence record. (Please use this identifier when citing information from GenBank.) Mandatory keyword/one or more records. VERSION - A compound identifier consisting of the primary accession number and a numeric version number associated with the current version of the sequence data in the record. This is optionally followed by an integer identifier (a "GI") assigned to the sequence by NCBI. Mandatory keyword/exactly one record. NOTE : Presentation of GI sequence identifiers in the GenBank flatfile format was discontinued as of March 2017. NID - An alternative method of presenting the NCBI GI identifier (described above). NOTE: The NID linetype is obsolete and was removed from the GenBank flatfile format in December 1999. PROJECT - The identifier of a project (such as a Genome Sequencing Project) to which a GenBank sequence record belongs. Optional keyword/one or more records. NOTE: The PROJECT linetype is obsolete and was removed from the GenBank flatfile format after Release 171.0 in April 2009. DBLINK - Provides cross-references to resources that support the existence a sequence record, such as the Project Database and the NCBI Trace Assembly Archive. Optional keyword/one or more records. KEYWORDS - Short phrases describing gene products and other information about an entry. Mandatory keyword in all annotated entries/one or more records. SEGMENT - Information on the order in which this entry appears in a series of discontinuous sequences from the same molecule. Optional keyword (only in segmented entries)/exactly one record. NOTE: The SEGMENT linetype is obsolete given the conversion of of all segmented sets to gapped CON-division records, completed as of GenBank Release 221.0 in August 2017. No new segmented set submissions will be accepted by GenBank. SOURCE - Common name of the organism or the name most frequently used in the literature. Mandatory keyword in all annotated entries/one or more records/includes one subkeyword. ORGANISM - Formal scientific name of the organism (first line) and taxonomic classification levels (second and subsequent lines). Mandatory subkeyword in all annotated entries/two or more records. In the event that the organism name exceeds 68 characters (80 - 13 + 1) in length, it will be line-wrapped and continue on a second line, prior to the taxonomic classification. Unfortunately, very long organism names were not anticipated when the fixed-length GenBank flatfile format was defined in the 1980s. The possibility of linewraps makes the job of flatfile parsers more difficult : essentially, one cannot be sure that the second line is truly a classification/lineage unless it consists of multiple tokens, delimited by semi-colons. The long-term solution to this problem is to introduce an additional subkeyword, possibly 'LINEAGE'. But because changes like this can be very disruptive for customers, implementation has not yet been scheduled. REFERENCE - Citations for all articles containing data reported in this entry. Includes seven subkeywords and may repeat. Mandatory keyword/one or more records. AUTHORS - Lists the authors of the citation. Optional subkeyword/one or more records. CONSRTM - Lists the collective names of consortiums associated with the citation (eg, International Human Genome Sequencing Consortium), rather than individual author names. Optional subkeyword/one or more records. TITLE - Full title of citation. Optional subkeyword (present in all but unpublished citations)/one or more records. JOURNAL - Lists the journal name, volume, year, and page numbers of the citation. Mandatory subkeyword/one or more records. MEDLINE - Provides the Medline unique identifier for a citation. Optional subkeyword/one record. NOTE: The MEDLINE linetype is obsolete and was removed from the GenBank flatfile format in April 2005. PUBMED - Provides the PubMed unique identifier for a citation. Optional subkeyword/one record. REMARK - Specifies the relevance of a citation to an entry. Optional subkeyword/one or more records. COMMENT - Cross-references to other sequence entries, comparisons to other collections, notes of changes in LOCUS names, and other remarks. Optional keyword/one or more records/may include blank records. FEATURES - Table containing information on portions of the sequence that code for proteins and RNA molecules and information on experimentally determined sites of biological significance. Optional keyword/one or more records. BASE COUNT - Summary of the number of occurrences of each basepair code (a, c, t, g, and other) in the sequence. Optional keyword/exactly one record. NOTE: The BASE COUNT linetype is obsolete and was removed from the GenBank flatfile format in October 2003. CONTIG - This linetype provides information about how individual sequence records can be combined to form larger-scale biological objects, such as chromosomes or complete genomes. Rather than presenting actual sequence data, a special join() statement on the CONTIG line provides the accession numbers and basepair ranges of the underlying records which comprise the object. As of August 2005, the 2L chromosome arm of Drosophila melanogaster (accession number AE014134) provided a good example of CONTIG use. ORIGIN - Specification of how the first base of the reported sequence is operationally located within the genome. Where possible, this includes its location within a larger genetic map. Mandatory keyword/exactly one record. - The ORIGIN line is followed by sequence data (multiple records). // - Entry termination symbol. Mandatory at the end of an entry/exactly one record. 3.4.3 Sample Sequence Data File An example of a complete sequence entry file follows. (This example has only two entries.) Note that in this example, as throughout the data bank, numbers in square brackets indicate items in the REFERENCE list. For example, in ACARR58S, [1] refers to the paper by Mackay, et al. 1 10 20 30 40 50 60 70 79 ---------+---------+---------+---------+---------+---------+---------+--------- GBSMP.SEQ Genetic Sequence Data Bank December 15 1992 GenBank Flat File Release 74.0 Structural RNA Sequences 2 loci, 236 bases, from 2 reported sequences LOCUS AAURRA 118 bp ss-rRNA RNA 16-JUN-1986 DEFINITION A.auricula-judae (mushroom) 5S ribosomal RNA. ACCESSION K03160 VERSION K03160.1 KEYWORDS 5S ribosomal RNA; ribosomal RNA. SOURCE A.auricula-judae (mushroom) ribosomal RNA. ORGANISM Auricularia auricula-judae Eukaryota; Fungi; Eumycota; Basidiomycotina; Phragmobasidiomycetes; Heterobasidiomycetidae; Auriculariales; Auriculariaceae. REFERENCE 1 (bases 1 to 118) AUTHORS Huysmans,E., Dams,E., Vandenberghe,A. and De Wachter,R. TITLE The nucleotide sequences of the 5S rRNAs of four mushrooms and their use in studying the phylogenetic position of basidiomycetes among the eukaryotes JOURNAL Nucleic Acids Res. 11, 2871-2880 (1983) FEATURES Location/Qualifiers rRNA 1..118 /note="5S ribosomal RNA" BASE COUNT 27 a 34 c 34 g 23 t ORIGIN 5' end of mature rRNA. 1 atccacggcc ataggactct gaaagcactg catcccgtcc gatctgcaaa gttaaccaga 61 gtaccgccca gttagtacca cggtggggga ccacgcggga atcctgggtg ctgtggtt // LOCUS ABCRRAA 118 bp ss-rRNA RNA 15-SEP-1990 DEFINITION Acetobacter sp. (strain MB 58) 5S ribosomal RNA, complete sequence. ACCESSION M34766 VERSION M34766.1 KEYWORDS 5S ribosomal RNA. SOURCE Acetobacter sp. (strain MB 58) rRNA. ORGANISM Acetobacter sp. Prokaryotae; Gracilicutes; Scotobacteria; Aerobic rods and cocci; Azotobacteraceae. REFERENCE 1 (bases 1 to 118) AUTHORS Bulygina,E.S., Galchenko,V.F., Govorukhina,N.I., Netrusov,A.I., Nikitin,D.I., Trotsenko,Y.A. and Chumakov,K.M. TITLE Taxonomic studies of methylotrophic bacteria by 5S ribosomal RNA sequencing JOURNAL J. Gen. Microbiol. 136, 441-446 (1990) FEATURES Location/Qualifiers rRNA 1..118 /note="5S ribosomal RNA" BASE COUNT 27 a 40 c 32 g 17 t 2 others ORIGIN 1 gatctggtgg ccatggcggg agcaaatcag ccgatcccat cccgaactcg gccgtcaaat 61 gccccagcgc ccatgatact ctgcctcaag gcacggaaaa gtcggtcgcc gccagayy // ---------+---------+---------+---------+---------+---------+---------+--------- 1 10 20 30 40 50 60 70 79 Example 9. Sample Sequence Data File 3.4.4 LOCUS Format 3.4.4.1 : Important notice about parsing the LOCUS line Users who process the data elements of the LOCUS line should use a token-based parsing approach rather than parsing its content based on fixed column positions. Historically, the LOCUS line has had a fixed length and its elements have been presented at specific column positions. A complete description of the data fields and their typical column positions is provided in Section 3.4.4.2 . But with the anticipated increases in the lengths of accession numbers, and the advent of sequences that are gigabases long, maintaining the column positions will not always be possible and the overall length of the LOCUS line could exceed 79 characters. Consider this LOCUS line for a typical complete bacterial genome: LOCUS CP032762 5868661 bp DNA circular BCT 15-OCT-2018 ------------+--------------+-+---------+---------+---------+---------+--------- 1 13 28 30 40 50 60 70 79 Now contrast this with a hypothetical gigabase-scale WGS sequence record that utilizes the 6 + 2 + 7/8/9 accession format: LOCUS AZZZAA02123456789 9999999999 bp DNA linear PRI 15-OCT-2018 ------------+--------------+-+---------+---------+---------+---------+--------- 1 13 28 30 40 50 60 70 79 Here, Locus-Name/Accession-Number must occupy the space at position 29 which normally separates the Locus from the Sequence Length. And if the sequence length had been 10 Gigabases or greater, the Locus-Name and Sequence Length would directly abut each other: LOCUS AZZZAA0212345678910000000000 bp DNA linear PRI 15-OCT-2018 ------------+--------------+-+---------+---------+---------+---------+--------- 1 13 28 30 40 50 60 70 79 In cases like this, a space would be introduced to ensure that the two fields are separated, all other values would be shifted to the right, and the length of the LOCUS line would increase: LOCUS AZZZAA02123456789 10000000000 bp DNA linear PRI 15-OCT-2018 ------------+--------------+-+---------+---------+---------+---------+--------- 1 13 28 30 40 50 60 70 79 Because the Locus-Name/Accession-Number is left-justified and the Sequence-Length is right-justified, *most* GenBank records will conform to the historical column positions that are described below. But since there will be exceptions, we recommend that users parse the LOCUS line based on whitespace-separated tokens. 3.4.4.2 : Data elements of the LOCUS line The data elements of the LOCUS line format and their typical/historical column positions are as follows: Positions Contents --------- -------- 01-05 'LOCUS' 06-12 spaces 13-28 Locus Name (usually identical to the Accession Number) 29-29 space 30-40 Sequence Length, right-justified 41-41 space 42-43 'bp' 44-44 space 45-47 Strandedness : spaces (if not known), ss- (single-stranded), ds- (double-stranded), or ms- (mixed-stranded) 48-53 Molecule Type: NA, DNA, RNA, tRNA (transfer RNA), rRNA (ribosomal RNA), mRNA (messenger RNA), uRNA (small nuclear RNA), cRNA (viral cRNA) Left justified. 54-55 space 56-63 Molecule Topology : 'linear' followed by two spaces, or 'circular' 64-64 space 65-67 Division Code 68-68 space 69-79 Update Date, in the form dd-MMM-yyyy (e.g., 15-MAR-1991) These column positions are typical/nominal, not guaranteed. See Section 3.4.4.1 for important suggestions about parsing the LOCUS line. The Locus Name element was originally designed to help group entries with similar sequences: the first three characters designated the organism; the fourth and fifth characters could be used to show other group designations, such as gene product; for segmented entries (now obsolete) the last character could be one of a series of sequential integers. Here are two examples of older GenBank records that have Locus Names : LOCUS HUMPDNRC 273 bp DNA linear PRI 04-OCT-1993 DEFINITION Human D9S125 polymorphic dinucleotide repeat. ACCESSION L10620 LOCUS HUMPDNRG 169 bp DNA linear PRI 04-OCT-1993 DEFINITION Human D9S114 polymorphic dinucleotide repeat. ACCESSION L10624 But in the mid-1990s, maintaining unique Locus Names in addition to unique Accession Numbers became unsustainable and the assignment of new Locus Names ceased. The overwhelming majority of sequence records now have no Locus Name, and their Accession Number is displayed on the LOCUS line instead. For example: LOCUS AF035771 1357 bp mRNA linear PRI 30-JUN-1998 DEFINITION Homo sapiens Na+/H+ exchanger regulatory factor 2 (NHERF-2) mRNA, complete cds. ACCESSION AF035771 The Division Code element of the LOCUS format is a three-letter abbreviation whose value can be : PRI - primate sequences ROD - rodent sequences MAM - other mammalian sequences VRT - other vertebrate sequences INV - invertebrate sequences PLN - plant, fungal, and algal sequences BCT - bacterial sequences VRL - viral sequences PHG - bacteriophage sequences SYN - synthetic sequences UNA - unannotated sequences EST - EST sequences (Expressed Sequence Tags) PAT - patent sequences STS - STS sequences (Sequence Tagged Sites) GSS - GSS sequences (Genome Survey Sequences) HTG - HTGS sequences (High Throughput Genomic sequences) HTC - HTC sequences (High Throughput cDNA sequences) ENV - Environmental sampling sequences CON - Constructed sequences TSA - Transcriptome Shotgun Assembly sequences The Molecule Type for all non-coding RNA sequences is 'RNA'. Further information about the specific type of non-coding RNA can be obtained from the full-length ncRNA feature that will be present on such sequences. 3.4.5 DEFINITION Format The DEFINITION record gives a brief description of the sequence, proceeding from general to specific. It starts with the common name of the source organism, then gives the criteria by which this sequence is distinguished from the remainder of the source genome, such as the gene name and what it codes for, or the protein name and mRNA, or some description of the sequence's function (if the sequence is non-coding). If the sequence has a coding region, the description may be followed by a completeness qualifier, such as cds (complete coding sequence). There is no limit on the number of lines that may be part of the DEFINITION. The last line must end with a period. 3.4.5.1 DEFINITION Format for NLM Entries The DEFINITION line for entries derived from journal-scanning at the NLM is an automatically generated descriptive summary that accompanies each DNA and protein sequence. It contains information derived from fields in a database that summarize the most important attributes of the sequence. The DEFINITION lines are designed to supplement the accession number and the sequence itself as a means of uniquely and completely specifying DNA and protein sequences. The following are examples of NLM DEFINITION lines: NADP-specific isocitrate dehydrogenase [swine, mRNA, 1 gene, 1585 nt] 94 kda fiber cell beaded-filament structural protein [rats, lens, mRNA Partial, 1 gene, 1873 nt] inhibin alpha {promoter and exons} [mice, Genomic, 1 gene, 1102 nt, segment 1 of 2] cefEF, cefG=acetyl coenzyme A:deacetylcephalosporin C o-acetyltransferase [Acremonium chrysogenum, Genomic, 2 genes, 2639 nt] myogenic factor 3, qmf3=helix-loop-helix protein [Japanese quails, embryo, Peptide Partial, 246 aa] The first part of the definition line contains information describing the genes and proteins represented by the molecular sequences. This can be gene locus names, protein names and descriptions that replace or augment actual names. Gene and gene product are linked by "=". Any special identifying terms are presented within brackets, such as: {promoter}, {N-terminal}, {EC 2.13.2.4}, {alternatively spliced}, or {3' region}. The second part of the definition line is delimited by square brackets, '[]', and provides details about the molecule type and length. The biological source, i.e., genus and species or common name as cited by the author. Developmental stage, tissue type and strain are included if available. The molecule types include: Genomic, mRNA, Peptide. and Other Genomic Material. Genomic molecules are assumed to be partial sequence unless "Complete" is specified, whereas mRNA and peptide molecules are assumed to be complete unless "Partial" is noted. 3.4.6 ACCESSION Format This field contains a series of six-character and/or eight-character identifiers called 'accession numbers'. The six-character accession number format consists of a single uppercase letter, followed by 5 digits. The eight-character accession number format consists of two uppercase letters, followed by 6 digits. The 'primary', or first, of the accession numbers occupies positions 13 to 18 (6-character format) or positions 13 to 20 (8-character format). Subsequent 'secondary' accession numbers (if present) are separated from the primary, and from each other, by a single space. In some cases, multiple lines of secondary accession numbers might be present, starting at position 13. The primary accession number of a GenBank entry provides a stable identifier for the biological object that the entry represents. Accessions do not change when the underlying sequence data or associated features change. Secondary accession numbers arise for a number of reasons. For example, a single accession number may initially be assigned to a sequence described in a publication. If it is later discovered that the sequence must be entered into the database as multiple entries, each entry would receive a new primary accession number, and the original accession number would appear as a secondary accession number on each of the new entries. In the event that a large number of continuous secondary accession numbers exist, a range can be employed: SecAccession1-SecAccession2 In such cases, the alphabetic prefix letters of the initial and terminal accession numbers within the range *MUST* be identical. For example: AE000111-AE000510O ^^ ^^ Additionally, the value of the numeric portion of the initial secondary within the range must be less than the value of the numeric portion of the terminal secondary. 3.4.7.1 VERSION Format This line contains a compound identifier consisting of the accession number plus the sequential version number of the associated sequence. LOCUS AF181452 1294 bp DNA PLN 12-OCT-1999 DEFINITION Hordeum vulgare dehydrin (Dhn2) gene, complete cds. ACCESSION AF181452 VERSION AF181452.1 ^^^^^^^^^^ Compound Accession.Version Number A compound Accession.Version consists of two parts: a stable, unchanging primary-accession number portion (see Section 3.4.6 for a description of accession numbers), and a sequentially increasing numeric version number. The accession and version numbers are separated by a period. The initial version number assigned to a new sequence is one. An accession number allows one to retrieve the same biological object in the database, regardless of any changes that are made to the entry over time. But those changes can include changes to the sequence data itself, which is of fundamental importance to many database users. So a numeric version number is associated with the sequence data in every database entry. If an entry (for example, AF181452) undergoes two sequence changes, its compound accession number on the VERSION line would start as AF181452.1 . After the first sequence change this would become: AF181452.2 . And after the second change: AF181452.3 . Numeric NCBI "GI" sequence identifiers also used to be included on the VERSION line, but that practice was discontinued in March of 2017. GenBank Releases contain only the most recent versions of all sequences in the database. However, older versions can be obtained via Accession.Version-based queries with NCBI's web-Entrez and network-Entrez applications. A sequence 'revision history' resource is also available, within Entrez:Nucleotide. For example: http://www.ncbi.nlm.nih.gov/nuccore/AF123456.1?report=girevhist NOTE: All the version numbers for the compound Accession.Version identifier system were initialized to a value of one (".1") in February 1999, when the system was first introduced. 3.4.7.2 DBLINK Format This line contains cross-references to other underlying resources that support the existence of a GenBank sequence record. For example: LOCUS ANHA01000001 503 bp DNA linear BCT 23-NOV-2012 DEFINITION Campylobacter coli BIGS0016 3011, whole genome shotgun sequence. ACCESSION ANHA01000001 ANHA01000000 VERSION ANHA01000001.1 DBLINK BioProject: PRJNA177352 BioSample: SAMN01795900 A DBLINK cross-reference consists of two data fields delimited by a colon. The first field provides the cross-reference type ("BioProject"), while the second contains the actual cross-reference identifier ("PRJNA177352"). The second field can consist of multiple comma-separated identifiers, if a sequence record has multiple DBLINK cross-references of a given type. For example: DBLINK BioProject:PRJNA174162,PRJNA999998,PRJNA999999 And, as in this example, there can be multiple distinct types of DBLINK cross-references. Each new type will start on a new line, with the first colon-delimited token being the name of the cross-referenced resource. As of April 2013, the supported DBLINK cross-reference types are "Project" (predecessor of BioProject), "BioProject", "BioSample", "Trace Assembly Archive", "Sequence Read Archive", and "Assembly". DBLINK cross-references of type 'BioProject' are BioProject Accession Number identifiers within the Entrez:BioProject resource at the NCBI: http://www.ncbi.nlm.nih.gov/bioproject At the above URL, a search for PRJNA177352 would provide information about the Campylobacter coli sequencing project (underway or completed), the center(s) performing the sequencing and annotation, information about the organism, etc. For a more detailed overview of NCBI's BioProject resource: http://www.ncbi.nlm.nih.gov/books/NBK54016/ DBLINK cross-references of type 'Assembly' are AssemblyID identifiers within the Assembly resource at NCBI: http://www.ncbi.nlm.nih.gov/assembly At the above URL, a search for GCA_000321225.1 would provide assembly details and statistics for the Odobenus rosmarus divergens (Pacific walrus) genome assembly submitted by the center(s) that performed the assembly. For a more detailed overview of NCBI's Assembly resource: http://www.ncbi.nlm.nih.gov/assembly/help/ 3.4.8 KEYWORDS Format The KEYWORDS field does not appear in unannotated entries, but is required in all annotated entries. Keywords are separated by semicolons; a "keyword" may be a single word or a phrase consisting of several words. Each line in the keywords field ends in a semicolon; the last line ends with a period. If no keywords are included in the entry, the KEYWORDS record contains only a period. 3.4.9 SEGMENT Format NOTE: The SEGMENT linetype is obsolete given the conversion of of all segmented sets to gapped CON-division records, completed as of GenBank Release 221.0 in August 2017. No new segmented set submissions will be accepted by GenBank. The SEGMENT keyword is used when two (or more) entries of known relative orientation are separated by a short (<10 kb) stretch of DNA. It is limited to one line of the form `n of m', where `n' is the segment number of the current entry and `m' is the total number of segments. 3.4.10 SOURCE Format The SOURCE field consists of two parts. The first part is found after the SOURCE keyword and contains free-format information including an abbreviated form of the organism name followed by a molecule type; multiple lines are allowed, but the last line must end with a period. The second part consists of information found after the ORGANISM subkeyword. The formal scientific name for the source organism (genus and species, where appropriate) is found on the same line as ORGANISM. The records following the ORGANISM line list the taxonomic classification levels, separated by semicolons and ending with a period. 3.4.11 REFERENCE Format The REFERENCE field consists of five parts: the keyword REFERENCE, and the subkeywords AUTHORS, TITLE (optional), JOURNAL, MEDLINE (optional), PUBMED (optional), and REMARK (optional). The REFERENCE line contains the number of the particular reference and (in parentheses) the range of bases in the sequence entry reported in this citation. Additional prose notes may also be found within the parentheses. The numbering of the references does not reflect publication dates or priorities. The AUTHORS line lists the authors in the order in which they appear in the cited article. Last names are separated from initials by a comma (no space); there is no comma before the final `and'. The list of authors ends with a period. The TITLE line is an optional field, although it appears in the majority of entries. It does not appear in unpublished sequence data entries that have been deposited directly into the GenBank data bank, the European Nucleotide Archive, or the DNA Data Bank of Japan. The TITLE field does not end with a period. The JOURNAL line gives the appropriate literature citation for the sequence in the entry. The word `Unpublished' will appear after the JOURNAL subkeyword if the data did not appear in the scientific literature, but was directly deposited into the data bank. For published sequences the JOURNAL line gives the Thesis, Journal, or Book citation, including the year of publication, the specific citation, or In press. For Book citations, the JOURNAL line is specially-formatted, and includes: editor name(s) book title page number(s) publisher-name/publisher-location year For example: LOCUS AY277550 1440 bp DNA linear BCT 17-JUN-2003 DEFINITION Stenotrophomonas maltophilia strain CSC13-6 16S ribosomal RNA gene, partial sequence. ACCESSION AY277550 .... REFERENCE 1 (bases 1 to 1440) AUTHORS Gonzalez,J.M., Laiz,L. and Saiz-Jimenez,C. TITLE Classifying bacterial isolates from hypogean environments: Application of a novel fluorimetric method dor the estimation of G+C mol% content in microorganisms by thermal denaturation temperature JOURNAL (in) Saiz-Jimenez,C. (Ed.); MOLECULAR BIOLOGY AND CULTURAL HERITAGE: 47-54; A.A. Balkema, The Netherlands (2003) The presence of "(in)" signals the fact that the reference is for a book rather than a journal article. A semi-colon signals the end of the editor names. The next semi-colon signals the end of the page numbers, and the colon that immediately *precedes* the page numbers signals the end of the book title. The publisher name and location are a free-form text string. Finally, the year appears at the very end of the JOURNAL line, enclosed in parentheses. The MEDLINE line provides the National Library of Medicine's Medline unique identifier for a citation (if known). Medline UIs are 8 digit numbers. The PUBMED line provides the PubMed unique identifier for a citation (if known). PUBMED ids are numeric, and are record identifiers for article abstracts in the PubMed database : http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed Citations in PubMed that do not fall within Medline's scope will have only a PUBMED identifier. Similarly, citations that *are* in Medline's scope but which have not yet been assigned Medline UIs will have only a PUBMED identifier. If a citation is present in both the PubMed and Medline databases, both a MEDLINE and a PUBMED line will be present. The REMARK line is a textual comment that specifies the relevance of the citation to the entry. 3.4.12 FEATURES Format GenBank releases use a feature table format designed jointly by GenBank, the European Nucleotide Archive, and the DNA Data Bank of Japan. This format is in use by all three databases. The most complete and accurate Feature Table documentation can be found on the Web at: http://www.insdc.org/documents/feature-table The feature table contains information about genes and gene products, as well as regions of biological significance reported in the sequence. The feature table contains information on regions of the sequence that code for proteins and RNA molecules. It also enumerates differences between different reports of the same sequence, and provides cross-references to other data collections, as described in more detail below. The first line of the feature table is a header that includes the keyword `FEATURES' and the column header `Location/Qualifiers.' Each feature consists of a descriptor line containing a feature key and a location (see sections below for details). If the location does not fit on this line, a continuation line may follow. If further information about the feature is required, one or more lines containing feature qualifiers may follow the descriptor line. The feature key begins in column 6 and may be no more than 15 characters in length. The location begins in column 22. Feature qualifiers begin on subsequent lines at column 22. Location, qualifier, and continuation lines may extend from column 22 to 80. Feature tables are required, due to the mandatory presence of the source feature. The sections below provide a brief introduction to the feature table format. 3.4.12.1 Feature Key Names The first column of the feature descriptor line contains the feature key. It starts at column 6 and can continue to column 20. The list of valid feature keys is available at: http://www.insdc.org/documents/feature-table#7.2 3.4.12.2 Feature Location The second column of the feature descriptor line designates the location of the feature in the sequence. The location descriptor begins at position 22. Several conventions are used to indicate sequence location. Base numbers in location descriptors refer to numbering in the entry, which is not necessarily the same as the numbering scheme used in the published report. The first base in the presented sequence is numbered base 1. Sequences are presented in the 5' to 3' direction. Location descriptors can be one of the following: 1. A single base; 2. A contiguous span of bases; 3. A site between two bases; 4. A single base chosen from a range of bases; 5. A single base chosen from among two or more specified bases; 6. A joining of sequence spans; 7. A reference to an entry other than the one to which the feature belongs (i.e., a remote entry), followed by a location descriptor referring to the remote sequence; A site between two residues, such as an endonuclease cleavage site, is indicated by listing the two bases separated by a carat (e.g., 23^24). A single residue chosen from a range of residues is indicated by the number of the first and last bases in the range separated by a single period (e.g., 23.79). The symbols < and > indicate that the end point of the range is beyond the specified base number. A contiguous span of bases is indicated by the number of the first and last bases in the range separated by two periods (e.g., 23..79). The symbols < and > indicate that the end point of the range is beyond the specified base number. Starting and ending positions can be indicated by base number or by one of the operators described below. Operators are prefixes that specify what must be done to the indicated sequence to locate the feature. The following are the operators available, along with their most common format and a description. complement (location): The feature is complementary to the location indicated. Complementary strands are read 5' to 3'. join (location, location, .. location): The indicated elements should be placed end to end to form one contiguous sequence. order (location, location, .. location): The elements are found in the specified order in the 5 to 3 direction, but nothing is implied about the rationality of joining them. 3.4.12.3 Feature Qualifiers Qualifiers provide additional information about features. They take the form of a slash (/) followed by a qualifier name and, if applicable, an equal sign (=) and a qualifier value. Feature qualifiers begin at column 22. The list of valid feature keys is available at: http://www.insdc.org/documents/feature-table#7.3 Qualifiers convey many types of information. Their values can, therefore, take several forms: 1. Free text; 2. Controlled vocabulary or enumerated values; 3. Citations or reference numbers; 4. Sequences; Text qualifier values must be enclosed in double quotation marks. The text can consist of any printable characters (ASCII values 32-126 decimal). If the text string includes double quotation marks, each set must be `escaped' by placing a double quotation mark in front of it (e.g., /note="This is an example of ""escaped"" quotation marks"). Some qualifiers require values selected from a limited set of choices. For example, as of June 2022 the `/exception' qualifier has only four allowed values: 'RNA editing', 'reasons given in citation', 'rearrangement required for product', and 'annotated by transcript or proteomic data'. These are known as controlled vocabulary qualifier values. Controlled qualifier values are case sensitive. Citation or published reference numbers for the entry should be enclosed in square brackets ([]) to distinguish them from other numbers. A literal sequence of bases (e.g., "atgcatt") should be enclosed in quotation marks. Literal sequences are distinguished from free text by context. Qualifiers that take free text as their values do not take literal sequences, and vice versa. 3.4.12.4 Cross-Reference Information One type of information in the feature table lists cross-references to the annual compilation of transfer RNA sequences in Nucleic Acids Research, which has kindly been sent to us on CD-ROM by Dr. Sprinzl. Each tRNA entry of the feature table contains a /note= qualifier that includes a reference such as `(NAR: 1234)' to identify code 1234 in the NAR compilation. When such a cross-reference appears in an entry that contains a gene coding for a transfer RNA molecule, it refers to the code in the tRNA gene compilation. Similar cross-references in entries containing mature transfer RNA sequences refer to the companion compilation of tRNA sequences published by D.H. Gauss and M. Sprinzl in Nucleic Acids Research. 3.4.12.5 Feature Table Examples In the first example a number of key names, feature locations, and qualifiers are illustrated, taken from different sequences. The first table entry is a coding region consisting of a simple span of bases and including a /gene qualifier. In the second table entry, an NAR cross-reference is given (see the previous section for a discussion of these cross-references). The third and fourth table entries use the symbols `<`and `>' to indicate that the beginning or end of the feature is beyond the range of the presented sequence. In the fifth table entry, the symbol `^' indicates that the feature is between bases. 1 10 20 30 40 50 60 70 79 ---------+---------+---------+---------+---------+---------+---------+--------- CDS 5..1261 /product="alpha-1-antitrypsin precursor" /map="14q32.1" /gene="PI" tRNA 1..87 /note="Leu-tRNA-CAA (NAR: 1057)" /anticodon=(pos:35..37,aa:Leu) mRNA 1..>66 /note="alpha-1-acid glycoprotein mRNA" transposon <1..267 /note="insertion element IS5" misc_recomb 105^106 /note="B.subtilis DNA end/IS5 DNA start" conflict 258 /replace="t" /citation=[2] ---------+---------+---------+---------+---------+---------+---------+--------- 1 10 20 30 40 50 60 70 79 Example 10. Feature Table Entries The next example shows the representation for a CDS annotated on a scaffold/ CON-division entry built from contigs of the LQNL01 WGS project: 1 10 20 30 40 50 60 70 79 ---------+---------+---------+---------+---------+---------+---------+--------- LOCUS KZ271580 141308 bp DNA linear CON 17-AUG-2017 DEFINITION Onchocerca flexuosa isolate Red Deer unplaced genomic scaffold O_flexuosa-1.0_Cont1703, whole genome shotgun sequence. ACCESSION KZ271580 LQNL01000000 VERSION KZ271580.1 DBLINK BioProject: PRJNA230512 BioSample: SAMN04226856 KEYWORDS WGS; HIGH_QUALITY_DRAFT. ... mRNA complement(join(<1..1557,1914..2102,2273..2312)) /locus_tag="X798_08235" /product="hypothetical protein" CDS complement(join(<1..1557,1914..2102,2273..2312)) /locus_tag="X798_08235" /codon_start=1 /product="hypothetical protein" /protein_id="OZC04795.1" /db_xref="GI:1233056989" /translation="MPKKQKSKIPESSGESAHSPIWSVTRRQRTELSPRRDDEIGSTQ SFSSRTVTTTERVQMIPLPVTFDAPVDVLTPTGRNERFLATTKITSESYSLPVIGGIT ISGAPLYTGLYIVPKTTKTRNVRTMMTTTTTTTYSAIEINDNEEELKVETEEKTVPQS TRITLDFPMDYEVVDFEDLLAASPAEEKEHLYVVVGKKDSPTRTTDAADYVVKMIDID LPSSESKDSPSIERISDAEIEGLMTEIEEGYSDRHDYDAYEGTIASTSRSNEIDQEPI HRYVTVYHNGISSEKLSPEVERISKEVSTVVAKLSGAYKRASIEGEHIIYTDTKTGQT LQKGTQSENRQIGESPRRLKSTYTVRFSDPFRIEADDYPWTQQENQSEIIFQKEKKDQ IGTLDEWQKEKDQQTQINQKGAKIIEEIRQKKPVNAGKLITGLFKKGETYLDYPATET YKGPVDSTYRILDVESEPIEQLVSVYHNGRSDEFVPIEEKKPSIDVGEVFTDAAQALG AKITGLFKRGPAHLDYPTSGPYDGPLASTSLALDVEGEPLQQHVNVYHSGRSDEPMIK IVEIPTEIPVEEVLEEKPIVTAKIITGLF" CONTIG join(LQNL01005322.1:1..30605,gap(100),LQNL01005323.1:1..85586, gap(100),LQNL01005324.1:1..24917) // ---------+---------+---------+---------+---------+---------+---------+--------- 1 10 20 30 40 50 60 70 79 Example 11. Scaffold/CON-division join() sequence 3.4.13 ORIGIN Format The ORIGIN record may be left blank, may appear as `Unreported.' or may give a local pointer to the sequence start, usually involving an experimentally determined restriction cleavage site or the genetic locus (if available). The ORIGIN record ends in a period if it contains data, but does not include the period if the record is left empty (in contrast to the KEYWORDS field which contains a period rather than being left blank). 3.4.14 SEQUENCE Format The nucleotide sequence for an entry is found in the records following the ORIGIN record. The sequence is reported in the 5' to 3' direction. There are sixty bases per record, listed in groups of ten bases followed by a blank, starting at position 11 of each record. The number of the first nucleotide in the record is given in columns 4 to 9 (right justified) of the record. 3.4.15 CONTIG Format As an alternative to SEQUENCE, a CONTIG record can be present following the ORIGIN record. A join() statement utilizing a syntax similar to that of feature locations (see the Feature Table specification mentioned in Section 3.4.12) provides the accession numbers and basepair ranges of other GenBank sequences which contribute to a large-scale biological object, such as a chromosome or complete genome. Here is an example of the use of CONTIG : CONTIG join(AE003590.3:1..305900,AE003589.4:61..306076, AE003588.3:61..308447,AE003587.4:61..314549,AE003586.3:61..306696, AE003585.5:61..343161,AE003584.5:61..346734,AE003583.3:101..303641, [ lines removed for brevity ] AE003782.4:61..298116,AE003783.3:16..111706,AE002603.3:61..143856) However, the CONTIG join() statement can also utilize a special operator which is *not* part of the syntax for feature locations: gap() : Gap of unknown length. gap(X) : Gap with an estimated integer length of X bases. To be represented as a run of n's of length X in the sequence that can be constructed from the CONTIG line join() statement . gap(unkX) : Gap of unknown length, which is to be represented as an integer number (X) of n's in the sequence that can be constructed from the CONTIG line join() statement. The value of this gap operator consists of the literal characters 'unk', followed by an integer. Here is an example of a CONTIG line join() that utilizes the gap() operator: CONTIG join(complement(AADE01002756.1:1..10234),gap(1206), AADE01006160.1:1..1963,gap(323),AADE01002525.1:1..11915,gap(1633), AADE01005641.1:1..2377) The first and last elements of the join() statement may be a gap() operator. But if so, then those gaps should represent telomeres, centromeres, etc. Consecutive gap() operators are illegal. 4. ALTERNATE RELEASES NCBI is supplying sequence data in the GenBank flat file format to maintain compatibility with existing software which require that particular format. Although we have made every effort to ensure that these data are presented in the traditional flat file format, if you encounter any problems in using these data with software which is based upon the flat file format, please contact us at: info@ncbi.nlm.nih.gov The flat file is just one of many possible report formats that can be generated from the richer representation supported by the ASN.1 form of the data. Developers of new software tools should consider using the ASN.1 form directly to take advantage of those features. Documentation and a Software Developer's Toolkit for ASN.1 are available through NCBI. The Software Developer's Toolkit and PostScript documentation for Linux, MacOS and Microsoft Windows systems is available in a compressed UNIX tar file by anonymous ftp from 'ftp.ncbi.nih.gov', in the toolbox/ncbi_tools++ directory. The file is 'ncbi_cxx--18_0_0.tar.gz'. 5. KNOWN PROBLEMS OF THE GENBANK DATABASE 5.1 Incorrect Gene Symbols in Entries and Index The /gene qualifier for many GenBank entries contains values other than the official gene symbol, such as the product or the standard name of the gene. 6. GENBANK ADMINISTRATION The National Center for Biotechnology Information (NCBI), National Library of Medicine, National Institutes of Health, is responsible for the production and distribution of the NIH GenBank Sequence Database. NCBI distributes GenBank sequence data by anonymous FTP, e-mail servers and other network services. For more information, you may contact NCBI at the e-mail address: info@ncbi.nlm.nih.gov . 6.1 Registered Trademark Notice GenBank (R) is a registered trademark of the U.S. Department of Health and Human Services for the Genetic Sequence Data Bank. 6.2 Citing GenBank If you have used GenBank in your research, we would appreciate it if you would include a reference to GenBank in all publications related to that research. When citing data in GenBank, it is appropriate to give the sequence name, primary accession number, and the publication in which the sequence first appeared. If the data are unpublished, we urge you to contact the group which submitted the data to GenBank to see if there is a recent publication or if they have determined any revisions or extensions of the data. It is also appropriate to list a reference for GenBank itself. The following publication, which describes the GenBank database, should be cited: Sayers EW, Cavanaugh M, Clark K, Pruitt KD, Sherry ST, Yankie L, Karsch-Mizrachi I, "GenBank 2024 update", Nucleic Acids Research, Volume 52, Issue D1, January 2024, pp. D134-D137. PMID: 37889039 PMCID: PMC10767886 DOI: 10.1093/nar/gkad903 The following statement is an example of how one might cite GenBank data. It cites the sequence, its primary accession number, the group who determined the sequence, and GenBank. The numbers in parentheses refer to the GenBank citation above and to the REFERENCE in the GenBank sequence entry. `We scanned the GenBank (1) database for sequence similarities and found one sequence (2), GenBank accession number V00002, which showed significant similarity...' (1) Sayers, EW. et al, Nucleic Acids Res. 52(D1):D134-D137 (2024) (2) Nellen, W. and Gallwitz, D. J. Mol. Biol. 159, 1-18 (1982) 6.3 GenBank Distribution Formats and Media Complete flat file releases of the GenBank database are available via NCBI's anonymous ftp server: ftp://ftp.ncbi.nih.gov Each release is cumulative, incorporating all previous GenBank data. No retrieval software is provided. GenBank distribution via CD-ROM ceased as of GenBank Release 106.0 (April, 1998). 6.4 Other Methods of Accessing GenBank Data Entrez is a molecular biology database system that presents an integrated view of DNA and protein sequence data, 3D structure data, complete genomes, and associated PubMed articles. The system is produced by the National Center for Biotechnology Information (NCBI), and is available only via the Internet (using the Web-Entrez and Network-Entrez applications). Accessing Entrez is easy: Simply direct your web browser of choice to: http://www.ncbi.nlm.nih.gov/ The Web version of Entrez has all the capabilities of the network version, but with the visual style of the World Wide Web. If you prefer the "look and feel" of Network-Entrez, you may download Network-Entrez from the NCBI's FTP server: ftp://ftp.ncbi.nih.gov/ Versions are available for PC/Windows, Macintosh and several Unix variants. For information about Network-Entrez, Web-Entrez or any other NCBI services, you may contact NCBI by e-mail at info@ncbi.nlm.nih.gov . 6.5 Request for Corrections and Comments We welcome your suggestions for improvements to GenBank. We are especially interested to learn of errors or inconsistencies in the data. BankIt or Genome Workbench can be used to submit revisions to previous submissions. In addition, suggestions and corrections can be sent by electronic mail to: update@ncbi.nlm.nih.gov. Please be certain to indicate the primary accession number of the entry to which your comments apply; it is helpful if you also give the entry name and the current contents of any data field for which you are recommending a change. 6.6 Credits and Acknowledgments Credits - GenBank Release Coordination Mark Cavanaugh GenBank Submission Coordination Ilene Mizrachi GenBank Annotation Staff Michael Baxter, Shelby Bidwell, Lori Black, Larissa Brown, Vincent Calhoun, Andreina Castillo Siri, Larry Chlumsky, Karen Clark, Scott Durkin, Michel Eschenbrenner, Michael Fetchko, Linda Frisse, Andrea Gocke, Anjanette Johnston, Erica Lam, Mark Landree, Jason Lowry, Richard McVeigh, Ilene Mizrachi, DeAnne Olsen Cravaritis, Leigh Riley, Susan Schafer, Augustus Tilley, Beverly Underwood, and Linda Yankie Data Management and Preparation Serge Bazhin, Evgueni Belyi, Colleen Bollin, Mark Cavanaugh, Yoon Choi, Sergey Dikunov, Ilya Dondoshansky, Justin Foley, Viatcheslav Gorelenkov, Sergiy Gotvyanskyy, Eugene Gribov, Sergei Kalashnikov, Jonathan Kans, Leonid Khotomliansky, Michael Kimelman, Dmitri Kishchukov, Michael Kornbluh, Alex Kotliarov, Frank Ludwig, Vasuki Palanigobu, Anton Perkov, Andriy Petrow, Sergey Petrunin, Dmitrii Saprykin, Wenyao Shi, Denis Sinyakov, Thomas Smith, Vladimir Soussov, Vitaly Stakhovsky, Elena Starchenko, Hanzhen Sun, Andrei Vereshchagin, Jewen Xiao, Liwei Zhou Database Administration Viatcheslav Khotomliansky, Igor Lozitskiy, Craig Oakley, Yevgeniy Semenov, Benjamin Slade, Constantin Vasilyev Customer Support David Brodsky, Hanguan Liu, Cooper Park, Monica Romiti, Eric Sayers, Majda Valjavec-Gratian Project Direction/Leadership Steve Sherry : Acting Director, NLM Kim Pruitt : Acting Director, NCBI Valerie Schneider : Acting Branch Chief, NCBI/IEB Eugene Yaschenko : Chief Technology Officer, NCBI/IRB Acknowledgments - Contractor support for GenBank production and distribution has been provided by Management Systems Designers, Inc., ComputerCraft Corporation, and The KEVRIC Company, Inc. 6.7 Disclaimer The United States Government makes no representations or warranties regarding the content or accuracy of the information. The United States Government also makes no representations or warranties of merchantability or fitness for a particular purpose or that the use of the sequences will not infringe any patent, copyright, trademark, or other rights. The United States Government accepts no responsibility for any consequence of the receipt or use of the information. For additional information about GenBank releases, please contact NCBI by e-mail at info@ncbi.nlm.nih.gov, or by mail at: GenBank National Library of Medicine Bldg. 38A Rm. 8N-809 8600 Rockville Pike Bethesda, MD 20894