Learn more: PMC Disclaimer | PMC Copyright Notice
Genome-wide investigation of the TGF-β superfamily in scallops
Abstract
Background
Transforming growth factor β (TGF-β) superfamily genes can regulate various processes, especially in embryogenesis, adult development, and homeostasis. To understand the evolution and divergence patterns of the TGF-β superfamily in scallops, genome-wide data from the Bay scallop (Argopecten irradians), the Zhikong scallop (Chlamys farreri) and the Yesso scallop (Mizuhopecten yessoensis) were systematically analysed using bioinformatics methods.
Results
Twelve members of the TGF-β superfamily were identified for each scallop. The phylogenetic tree showed that these genes were grouped into 11 clusters, including BMPs, ADMP, NODAL, GDF, activin/inhibin and AMH. The number of exons and the conserved motif showed some differences between different clusters, while genes in the same cluster exhibited high similarity. Selective pressure analysis revealed that the TGF-β superfamily in scallops was evolutionarily conserved. The spatiotemporal expression profiles suggested that different TGF-β members have distinct functions. Several BMP-like and NODAL-like genes were highly expressed in early developmental stages, patterning the embryonic body plan. GDF8/11-like genes showed high expression in striated muscle and smooth muscle, suggesting that these genes may play a critical role in regulating muscle growth. Further analysis revealed a possible duplication of AMH, which played a key role in gonadal growth/maturation in scallops. In addition, this study found that several genes were involved in heat and hypoxia stress in scallops, providing new insights into the function of the TGF-β superfamily.
Conclusion
Characteristics of the TGF-β superfamily in scallops were identified, including sequence structure, phylogenetic relationships, and selection pressure. The expression profiles of these genes in different tissues, at different developmental stages and under different stresses were investigated. Generally, the current study lays a foundation for further study of their pleiotropic biological functions in scallops.
Supplementary Information
The online version contains supplementary material available at 10.1186/s12864-023-09942-w.
Background
Scallops are bivalve molluscs that belong to the family Pectinidae and are widely distributed worldwide. Scallops play a critical role in benthic ecology, and many species are economically important fisheries and aquaculture species, providing high quality protein food for humans [1]. Improvement of growth-related traits is a major focus of scallop breeding. Investigating the genetic regulation of scallop growth could benefit scallop breeding. The transforming growth factor β (TGF-β) superfamily plays critical roles in cell proliferation, differentiation, adhesion, migration, and apoptosis [2–4], and is therefore a plausible candidate growth regulator in scallops.
The TGF-β superfamily is an evolutionarily conserved family of secreted polypeptide factors that has undergone minor changes in invertebrates and vertebrates [3]. A common characteristic of this family of proteins is the presence of 6–9 and usually 7 conserved cysteine residues [4]. Six of the cysteine residues form intramolecular disulfide bonds, and the seventh cysteine forms an intermolecular disulfide bond responsible for the covalent linkage of two subunits of the dimeric protein [5]. The TGF-β superfamily consists of a large group of cell regulatory proteins, such as TGF-βs (TGF-β1/2/3), Nodal, activin/inhibin, left-right determination factor (LEFTY), bone morphogenetic protein (BMP), growth and differentiation factor (GDF), anti-dorsalising morphogenetic protein (ADMP) and other superfamily genes [6]. The members are diverse and exhibit tissue-specific and developmental stage-dependent biological effects.
The TGF-β superfamily plays crucial roles in the development and homeostasis of several vital processes, including embryo differentiation, neurogenesis, cell cycle, apoptosis, mesoderm and endoderm induction, and left-right axis determination [4, 7]. In addition, the TGF-β superfamily plays a key role in muscle growth and development [8]. For example, GDF8, also known as myostatin (MSTN), is a conservative regulator of muscle growth and has become one of the most important target genes for genetic improvement in aquatic animals [9]. In scallops, the analysis of TGF-β superfamily genes has mainly focused on GDF8 [10–12]. However, few studies have suggested other functions of TGF-β members in scallops. In addition, several members of the TGF-β superfamily have also been identified as sex determination/differentiation genes [6]. For example, GDFs and BMPs are involved in both male and female germ cell growth and differentiation in scallops [13]. OgTGF-β has been implicated as an activator of germ cell development in oysters, and inhibition of ogTGF-β function tends to reduce the gonadal area [14, 15]. BMP, GDF, gonadal soma-derived factor (GSDF), activin and anti-Müllerian hormone (AMH) have also been identified as master sex-determining genes in some fish species [4, 6, 16–18]. Additionally, the TGF-β superfamily is an essential immunomodulatory molecular switch and is therefore important for the homeostatic maintenance of the immune system [19, 20].
Analyses of the TGF-β superfamily in scallops have thus far been limited to single species [13]. Expression profiles of most of the TGF-β superfamily genes in different tissues and developmental stages are still lacking. To date, several questions about the TGF-β superfamily in the scallop remain unanswered. For example, how many types of the TGF-β superfamily are present in scallops? How many TGF-β superfamily genes are present in different scallops? What are the functions of the different genes in scallops? Fortunately, sequencing of the scallop genome has greatly facilitated the identification and functional studies of related gene sequences [1, 21]. In the present study, a systematic identification and comprehensive analysis of the TGF-β superfamily was performed in three scallop genomes, including the Bay scallop (Argopecten irradians), the Zhikong scallop (Chlamys farreri) and the Yesso scallop (Mizuhopecten yessoensis). Characteristics of these genes were identified, including sequence structure, phylogenetic relationships, and selection pressure. Using transcriptome resources, we investigated the expression distribution of these genes in different tissues and at different developmental stages, as well as the expression patterns under different stress levels. The results of this study will provide a basis for understanding the gene structure, evolution, and function of the TGF-β superfamily in scallops.
Results
Identification and characterization of TGF-β superfamily proteins
Three scallop species have the same number of TGF-β genes, up to 12. The amino acid sequences of the identified TGF-β superfamily genes are given in Supplementary Table S1. The properties of all the identified TGF-β proteins were predicted and listed in Table 1. The AA length varied from 286 to 505. The molecular weight varied from 32.35 to 58.52 kDa, and the theoretical PI value varied from 5.53 to 10.05. The minimum instability index was 38.24, while the maximum value was 66.15. The aliphatic index ranged from 66.72 to 86.65. The maximum and minimum values for the grand average of hydropathicity were − 0.305 and − 0.84, respectively.
Table 1
Gene ID | Number of amino acid (AA) | Molecular weight (Da) | Theoretical Isoelecric point (PI) | Instability index | Aliphatic index | Grand average of hydropathicity |
---|---|---|---|---|---|---|
AiTGFB-01 | 407 | 46892.54 | 9.44 | 48.33 | 75.63 | -0.652 |
AiTGFB-02 | 500 | 58295.62 | 9.99 | 63.37 | 69.76 | -0.840 |
AiTGFB-03 | 424 | 49309.58 | 9.74 | 48.98 | 71.72 | -0.566 |
AiTGFB-04 | 433 | 50082.13 | 5.93 | 56.19 | 85.89 | -0.398 |
AiTGFB-05 | 504 | 58507.32 | 9.36 | 58.42 | 71.01 | -0.804 |
AiTGFB-06 | 328 | 37816.73 | 10.04 | 38.24 | 78.32 | -0.605 |
AiTGFB-07 | 459 | 53375.25 | 5.53 | 59.91 | 72.03 | -0.680 |
AiTGFB-08 | 406 | 46331.69 | 6.13 | 47.83 | 86.65 | -0.453 |
AiTGFB-09 | 492 | 56935.67 | 9.00 | 66.15 | 69.70 | -0.717 |
AiTGFB-10 | 286 | 32348.63 | 6.00 | 47.24 | 79.69 | -0.370 |
AiTGFB-11 | 395 | 44580.82 | 9.95 | 52.87 | 80.63 | -0.486 |
AiTGFB-12 | 320 | 36004.40 | 6.17 | 42.62 | 80.41 | -0.305 |
CfTGFB-01 | 406 | 46973.68 | 9.40 | 51.96 | 77.93 | -0.660 |
CfTGFB-02 | 503 | 58460.99 | 10.02 | 66.01 | 72.05 | -0.788 |
CfTGFB-03 | 418 | 48557.57 | 9.47 | 44.39 | 69.47 | -0.560 |
CfTGFB-04 | 428 | 49566.39 | 5.99 | 52.48 | 86.00 | -0.454 |
CfTGFB-05 | 505 | 58521.63 | 9.46 | 63.63 | 74.14 | -0.748 |
CfTGFB-06 | 364 | 41436.89 | 9.79 | 45.56 | 84.01 | -0.401 |
CfTGFB-07 | 421 | 48344.81 | 5.89 | 47.67 | 83.80 | -0.503 |
CfTGFB-08 | 457 | 52852.99 | 5.61 | 55.63 | 74.49 | -0.612 |
CfTGFB-09 | 378 | 43784.11 | 8.83 | 54.68 | 86.32 | -0.344 |
CfTGFB-10 | 473 | 53834.28 | 9.35 | 56.02 | 66.72 | -0.697 |
CfTGFB-11 | 399 | 45499.72 | 10.04 | 62.69 | 79.07 | -0.484 |
CfTGFB-12 | 350 | 40252.09 | 5.63 | 52.08 | 77.40 | -0.426 |
MyTGFB-01 | 406 | 46826.51 | 9.55 | 50.89 | 77.46 | -0.644 |
MyTGFB-02 | 503 | 58516.20 | 10.05 | 65.46 | 72.82 | -0.781 |
MyTGFB-03 | 421 | 48804.86 | 9.62 | 46.73 | 67.62 | -0.613 |
MyTGFB-04 | 431 | 49880.63 | 5.68 | 55.89 | 83.60 | -0.453 |
MyTGFB-05 | 505 | 58477.57 | 9.44 | 60.56 | 75.11 | -0.709 |
MyTGFB-06 | 366 | 41887.51 | 9.85 | 46.41 | 79.81 | -0.467 |
MyTGFB-07 | 410 | 47058.45 | 6.87 | 50.03 | 82.49 | -0.501 |
MyTGFB-08 | 457 | 53064.34 | 5.74 | 58.30 | 76.39 | -0.594 |
MyTGFB-09 | 487 | 55410.99 | 9.00 | 54.67 | 70.66 | -0.653 |
MyTGFB-10 | 397 | 44952.00 | 9.94 | 56.35 | 78.99 | -0.466 |
MyTGFB-11 | 379 | 43933.13 | 9.04 | 42.43 | 79.13 | -0.407 |
MyTGFB-12 | 351 | 40199.83 | 5.90 | 56.82 | 73.82 | -0.525 |
Phylogenetic analysis of TGF-β superfamily genes
Phylogenetic analysis was performed using the TGF-β protein sequences from a variety of animals, including mammals, fishes, insects, and roundworms. As shown in Fig. 1, all scallop TGF-β proteins were clearly grouped into 11 clusters (cluster I to cluster XI). Except for cluster XI, the other 10 clusters contained three members each from three scallop species. Cluster XI contained 6 genes and each species had two genes. The clusters from I to XI showed close phylogenetic relationships with BMP2/4, ADMP, BMP5-8, BMP9/10, BMP3/GDF10, NODAL, GDF15, GDF8/11, INHA, activin/INHB, and AMH, respectively (Table 2).
Table 2
Cluster | Gene name | ||
---|---|---|---|
A. irradians | C. farreri | M. yessoensis | |
BMP2/4-like | AiTGFβ-01 | CfTGFβ-01 | MyTGFβ-01 |
ADMP-like | AiTGFβ-02 | CfTGFβ-02 | MyTGFβ-02 |
BMP5-8-like | AiTGFβ-03 | CfTGFβ-03 | MyTGFβ-03 |
BMP9/10-like | AiTGFβ-04 | CfTGFβ-04 | MyTGFβ-04 |
BMP3/GDF10-like | AiTGFβ-05 | CfTGFβ-05 | MyTGFβ-05 |
NODAL-like | AiTGFβ-06 | CfTGFβ-06 | MyTGFβ-06 |
GDF15 | AiTGFβ-07 | CfTGFβ-07 | MyTGFβ-07 |
GDF8/11-like | AiTGFβ-08 | CfTGFβ-08 | MyTGFβ-08 |
INHA-like | AiTGFβ-09 | CfTGFβ-09 | MyTGFβ-09 |
Activin/INHB-like | AiTGFβ10 | CfTGFβ-10 | MyTGFβ10 |
AMH-like | AiTGFβ-11 | CfTGFβ-11 | MyTGFβ-11 |
AMH-like | AiTGFβ-12 | CfTGFβ-12 | MyTGFβ-12 |
Gene structure, motif, and genomic distribution
The conserved motif composition and exon-intron diversification of the TGF-β superfamily genes are shown in Fig. 2. Proteins in the same cluster had more similar motif structural features. Motifs 1–4 were included in the TGF-β domain. Seven conserved cysteine residues were present in these 4 motifs (Table 3). In addition, the number of exons in the TGF-β superfamily genes ranged from 2 to 6. Genes in the same cluster had the same number of exons. For example, the cluster III (BMP5-8-like) genes had 6 exons, while the cluster II (ADMP-like) genes had 5 exons. The other identified genes had 2 or 3 exons. It was suggested that all TGF-β superfamily genes contain the TGF-β domain, most of the identified genes contained a signal peptide and a Pfam: TGF-β propeptide, and several genes contained a low complexity region and a transmembrane domain. Only the ADMP-like and BMP3/GDF10-like genes contained a coiled coil region (Fig. 3).
Table 3
MEME Motif | Amino Acid Sequence | Length | Pfam Domain |
---|---|---|---|
1 | WIIAPKGYEAYYCVGECPFPL | 21 | TGF-β |
2 | SVPTPCCVPTKLSPJSLLYFDENENVVLK | 29 | TGF-β |
3 | NRESDICCRRPLYVDFHDIGW | 21 | TGF-β |
4 | PBMVVKSCGCR | 11 | TGF-β |
5 | YAKNAGWETFDVTBAVLKWINS | 21 | - |
6 | ESLNPTNHAIIQSLVHAJTPG | 21 | - |
7 | FFGIDRVPARVIHKSPPQFMIDLYASITEPGGLVKRESPYRADVIRSFPDREWRQQMHFYYNVSYLSEGEKLLAAEFHIFKLNPRPSSEGEQMPSHVIEI | 100 | - |
8 | AVNYGFLVTTTSPSGRHVNGSYVRFAQRKEHHESKQPILVAYTDDGMNRHPSYISPTDENYMQIKKDILKKQRQRMRQFKGKDFRQAIRLLNEREREEDQ | 100 | - |
9 | FBVSSITHSEVVTRAEJRJYKD | 22 | - |
10 | EKYENAQMQSDSPSRRKEEKLRYQDVQEEYGQPERTYSFAKELPADMSSEFENTIYFDMQVAPEKETNKALLWVYINPDDIIDKNMTEIYVYTIDPPGKF | 100 | - |
11 | QNNLFDNKFLDNVDSQQKKEILEAFESSLLNLFSLNARPRPKKDIKIPQYMIDLYKTHTKDPDVLSPNFNIRGKGVGTANTVRSFYHKDAEEHPVQMTGC | 100 | - |
12 | GRDKREMQHEILTLLGLHHRPKPAGHSTTDYSAPRFMLNLYNSITSDGGIVDDGNRPQFDRNVTIENEIEPIEGSDVIMSFVNHAKKIKHLRRQRDRTFY | 100 | - |
13 | MFHTVNLTVLLGVLVCVVLSREVSDGPQNVLLNESVKTLLGFKDEHPRDQVSSPYGVGQEAPKYMLDLYDRFRNSQISKGHLSGNTVRSIHAEIAEVNGE | 100 | - |
14 | SVQRRQKRSIFNNEIPEDPADYDNFHRKFNIPQTHPDILQSRRESRHKISDSRLIPYPDEDRRKNRRNNRKNRKNKRKNRRRKNKNSNLLFPKEWD | 96 | - |
15 | PGEVVTTLRADVKKTHWFKLGIPKQLVENAMLSEDQILRLHVHCRGCGRRVQLVLVHGSRRRRKSKGGKRKGSMRVMQPRKRPKRRLSQTRPFLILHTKV | 100 | - |
16 | PRAKVNMMKLKEQEHIENIKRRVLEKLRLDAPPKLSGPRPALPFKHLHQEYLSDGVDPGRRRRTLPEFYARKKQVLVMGTDVTTECTNRKSTGCYH | 96 | - |
17 | TDPPRGDYYAELLEVISFSEPAESFRDENIIQFKVVRDSQGRKLEVKSANVLVKLRYRRSKKRGRTSCRQKNRRSDVKKKPRRSRCKIIIVLSTVSEDGT | 100 | - |
18 | ENVFHSVSYGEMDIDARPKTRTEPLLVVFSSEYSKNKLHMKERHEMVTHEMDSFDFMGDLNDTQTNQSESNTLQHRFKR | 79 | - |
19 | RDGLFRKRIFLKKNRDVKPEKLGVLGRPGPEYKRPPKVPYF | 41 | - |
20 | DTPHLFALKFQVEWQNGKVKDVALKKFIRHHSMPFLIIYSNDTQNNELDSLENLAEKMHKEKKE | 64 | - |
Selective pressure analysis
The results of the selection pressure evaluation are shown in Table 4. In the branch model, the ω for the M0 model was 0.130, indicating that the TGF-β superfamily genes were under strong purifying selection. A comparison between M1 and M0 showed that different branches had similar ω values (PLRT > 0.05). The site model was then used to identify the positive selection sites. In the site model, the comparison between M3 and M0 suggested that variable alternative pressure existed among different sites (PLRT = 0). However, by comparing M2a/M1a and M8/M7, it can be concluded that there were no significant positive selection sites in the identified genes. Overall, the TGF-β superfamily genes in scallops were mainly constrained by purifying selection events.
Table 4
Branch Model | Model Type | np | LnL | Estimates of parameters | Model comparison | P LRT |
0 | 71 | -13405.594 | ω = 0.13009 | M1/M0 | 0.1561 | |
1 | 72 | -13404.588 | ||||
Site Model | M0 | 71 | -13315.825 | ω = 0.11829 | M3/M0 | 0.0000 |
M3 | 75 | -13142.984 | p: 0.06077, 0.41136, 0.52786; w: 0.00392, 0.06801, 0.17790 | |||
M1a | 72 | -13315.230 | p: 0.99524, 0.00476; w: 0.11821, 1.00000 | M2a/M1a | 1.0000 | |
M2a | 74 | -13315.230 | p: 0.99524, 0.00130, 0.00346; w: 0.11821, 1.00000, 1.00000 | |||
M7 | 72 | -13173.316 | p = 1.07769, q = 8.56326 | M8/M7 | 0.9984 | |
M8 | 74 | -13173.318 | p0 = 0.99999, p = 1.07769, q = 8.56327, (p1 = 0.00001), w = 1.00000 |
Spatiotemporal expression profiles of TGF-β superfamily genes in scallops
Similar expression patterns in the early developmental stages were first analysed in C. farreri (Fig. 4, A) and M. yessoensis (Fig. 4, B). CfTGFβ-03 (BMP5-8-like) showed high expression at the zygote and 2–8 cell stage, and MyTGFβ-03 (BMP5-8-like) was highly expressed at the 2–8 cell stage. CfTGFβ-06 and MyTGFβ-06, which were NODAL-like proteins, showed high and moderate expression at the blastula stage, respectively. At the gastrula, trochophore and D-stage veliger stage, CfTGFβ-05 and MyTGFβ-05, which were BMP3/GDF10-like proteins, showed high and moderate expression, respectively. Several genes showed species-specific expression patterns in C. farreri and M. yessoensis. GDF8/11-like (CfTGFβ-08) was highly expressed in the gastrula and was not detected in M. yessoensis. CfTGFβ-01 (BMP2/4-like) was highly or moderately expressed from the blastula to juvenile stages, whereas MyTGFβ-01 (BMP2/4-like) was expressed at low levels.
The spatial expression profiles of the TGF-β superfamily genes in adult tissues are shown in Fig. 5. Furthermore, the patterns of the gene expression of six CfTGF-β genes were verified by RT-qPCR, the results of which were consistent with the RNA-Seq analyses (Fig. 6). Interestingly, CfTGFβ-12 (AMH-like) was highly expressed in the gonads. MyTGFβ-12 (AMH-like) also showed specifically moderate expression levels in the male gonad. CfTGFβ-08 (GDF8/11-like) was highly expressed in mantle, striated muscle, smooth muscle, gill, and kidney, while MyTGFβ-08 (GDF8/11-like) showed higher expression in striated muscle than in other adult tissues. CfTGFβ-10 (activin/INHB-like) also showed a moderate expression level in smooth muscle. CfTGFβ-03 (BMP5-8-like) and MyTGFβ-03 (BMP5-8-like) were ubiquitously expressed in adult tissues. CfTGFβ-01, MyTGFβ-01, CfTGFβ-02, MyTGFβ-02, CfTGFβ-05 and MyTGFβ-05 showed high or moderate expression in the gill. In addition, the genes in cluster IV (BMP9/10),VI (NODAL-like), VII (GDF15-like), and IX (INHA-like) showed no or very low expression in the measured adult tissues. The TGF-β superfamily genes were not expressed in the hepatopancreas.
The expression profiles of TGF-β superfamily genes under heat stress or hypoxia stress in A. irradians, C. farreri and M. yessoensis are shown in Fig. 7. The statistical results are shown in Supplementary Table S2. Interestingly, the genes in cluster IV (AiTGFβ-04, CfTGFβ-04, MyTGFβ-04) were highly expressed under heat plus hypoxia stress in the three scallop species. Compared to the normal condition, the gene expression levels of genes in cluster VII (CfTGFβ-07 and MyTGFβ-07) were significantly different under heat plus hypoxia stress, which showed no difference only under heat stress or hypoxia stress alone. In addition to AiTGFβ-04, there was no differentially expressed gene (DEG) under heat and hypoxia stress in A. irradians, while there were three DEGs (CfTGFβ-01, CfTGFβ-08, CfTGFβ-11) and two DEGs (MyTGFβ-09, MyTGFβ-10) in C. farreri and M. yessoensis, respectively.
Discussion
To date, the number of TGF-β superfamily genes has been extensively studied in various animals, showing considerable differences among different organisms [22, 23]. In this study, a comprehensive survey of the TGF-β superfamily was carried out in scallops. Three scallop species had the same number of members in the TGF-β superfamily, which was much lower than that observed in many vertebrates [4]. For example, there are at least 30 in mammals [4, 24]. The number of TGF-β superfamily members in scallops was higher than that in oysters and some other invertebrates, such as fruit flies, leeches, and jellyfish [4]. The expansion of family members probably originated from the duplication of a common ancestral gene and was widely dispersed by chromosomal translocations [2, 25]. Gene duplication has been proposed as a primary mechanism for increasing organismal complexity and generating evolutionary novelty. There has been evidence for two rounds of genome duplication (2R) in vertebrates and additional rounds (3R or 4R) in teleosts [4, 26].
Previous studies have suggested that the first members of the TGF-β superfamily to appear were BMPs/GDFs, which subsequently differentiated into activin/inhibin, while the TGF-βs and LEFTY were more recent, appearing only in deuterostomes [2, 27, 28]. Consistent with previous findings, the current analysis showed that TGF-βs and LEFTY were absent in scallops. BMP, ADMP, GDF, NODAL, activin/inhibin, and AMH were identified in each scallop genome. The PI from the same cluster showed consistency. Most TGF-β superfamily proteins were unstable in nature (INS > 40). According to the aliphatic index, all proteins showed a hydrophilic nature. The characteristics of the TGF-β superfamily in scallops were similar to those in other species in previous studies [29], which showed that the TGF-β superfamily was evolutionarily conserved. This result can be supported by selection pressure analysis. The TGF-β superfamily genes in scallops have evolved under purifying selection. Different branches showed similar selective pressures, and no site was identified for the positive selection test. In general, purifying selection acts to selectively eliminate deleterious mutations, often resulting in a more conservative gene [30, 31]. In two artificially selective A. irradians breeds, the TGF-β type I receptor gene was detected to be selected and no TGF-β superfamily genes were under selection [32]. In general, these results suggested that the TGF-β superfamily was conserved in scallops.
In the current study, TGF-β superfamily genes were specifically expressed at different early developmental stages. BMP5-8-like (CfTGFβ-03 and MyTGFβ-03) were both highly expressed at the 2–8 cell stage. BMP3/GDF10-like (CfTGFβ-05 and MyTGFβ-05) and BMP2/4-like (CfTGFβ-01) showed high expression levels at several developmental stages. BMPs play key roles in gastrulation, mesoderm induction and axial patterning in the embryo [33]. BMP2/4 is a crucial factor for dorsal-ventral patterning in oysters [17]. In jellyfish and leeches, BMP2/4 and BMP5-8 have been implicated in larval axial development [34, 35]. In addition, NODAL-like genes (CfTGFβ-06 and MyTGFβ-06) were specifically highly expressed at the blastula stage. Previous reports have shown that NODAL is needed for early cell fate decisions, organogenesis, left-right development [36, 37], anterior-posterior body axis development [38] and the oral-aboral axis in the embryo [33]. In this study, several BMP-like and NODAL-like genes may play important roles in early development, patterning the embryonic body plan and later regulating development and homeostasis.
Previous studies have shown that GDF8/11 plays a critical role in regulating muscle growth [39]. For example, in M. yessoensis, inhibition of myostatin mRNA could increase a combination of hyperplasia and hypertrophy of myosin heavy chain (MHC) II striated myofibers in striated muscle, thereby increasing muscle cellularity [12]. The GDF8 gene is also associated with muscle growth in other scallops [11, 40]. SNPs in the myostatin gene have been developed as candidate molecular markers for selective breeding in C. farreri [10, 41] and the Noble scallop (Chlamys nobilis) [42]. Similar results were obtained in this study, where the GDF8/11-like gene (CfTGFβ-08) showed high expression in striated muscle and smooth muscle. MyTGFβ-08 also showed moderate expression in striated muscle, with low or no expression in other tissues. The results were consistent with previous studies in M. yessoensis [12, 43]. In addition, BMP5-8-like (CfTGFβ-03) and CfTGFβ-10 (activin/INHB-like) showed moderate expression levels in smooth muscle. To date, data on BMP5-8 and activin/inhibin in invertebrates are very limited and have rarely been reported in scallops. Activin/inhibin has been suggested to play an important role in spermatogenesis in mammals [44] and in the regulation of oocyte maturation in fish [45, 46]. Therefore, GDF8/11 can regulate muscle growth in scallops as in other species, and how other TGF-β superfamily genes are involved in muscle development should be further investigated in scallops.
Several TGF-β members have also been identified as sex determination/differentiation genes. BMP2a and BMP10a showed gonad-specific expression in M. yessoensis and the expression level of BMP2a showed seasonal changes at different gonad maturational stages [13]. In this study, there were one BMP2/4-like gene and one BMP9/10-like gene in all three scallop species. However, these two genes were not specifically expressed in the gonad in either C. farreri or M. yessoensis. This difference may be due to the different developmental stages of the gonads. In the current study, AMH-like genes (CfTGFβ-12 and MyTGFβ-12) showed specific expression levels in the gonad. “Amh-amhy-amhr2” acts as a master sex-determining gene in teleost fish, regulating germ cell proliferation and gonad development [47, 48]. Interestingly, AMH is duplicated in some fish, such as amhy (AMH on the Y chromosome) in Nile tilapia [49, 50], amhby (Y chromosome-specific copy of AMH) in northern pike [47], and amhy (Y-linked duplicates of AMH) in Patagonian pejerrey [51] and Sebastes rockfish [52]. In these species, a duplicate copy of AMH acts as a master sex-determining gene [48]. In Nile tilapia, loss of amhy function in XY fish resulted in male to female sex reversal, while overexpression of AMH resulted in female to male sex reversal [53]. C. farreri and M. yessoensis are gonochoristic species and the ZW-type sex chromosomes are homomorphic chromosomes [54]. AMH is also needed to drive testicular development in a reptilian species, the Chinese soft-shelled turtle, a typical species exhibiting ZZ/ZW sex chromosomes [55]. In scallops, the genes highly expressed in the gonads were from cluster XI. The 6 genes in this cluster shared a high nucleotide identity, and the genes in scallops may have similar functions in other species. Therefore, there may be a duplication of autosomal AMH that was later translocated to the ancestral sex chromosome. This information here provides new insights into the important role of AMH in gonadal growth/maturation in scallops.
The expression profiles of TGF-β superfamily genes under heat stress or hypoxia stress were significantly different from those under heat plus hypoxia stress in scallops. For example, the genes in cluster IV (BMP9/10-like) were both highly expressed under heat plus hypoxia stress in three scallop species. These observations indicated that BMP9/10-like genes may be involved in the combined stress of multiple factors. The genes in cluster VII were significantly differentially expressed under heat stress and hypoxia stress in both C. farreri and M. yessoensis. TGF-β superfamily genes are known to control a wide range of biological processes, including immunosuppression and apoptosis induction. There is evidence that hypoxia stress can induce apoptosis, inflammation, and autophagy in marine bivalves [56]. TGF-β transcription increased in Nile tilapia [57] and rainbow trout [58] during exposure to hypoxia. BMP-4 was significantly downregulated under short-term salinity stress in abalone [59]. However, few studies have reported the function of the TGF-β superfamily in stress tolerance in scallops. In general, this study provided a fundamental clue for understanding the important roles of the TGF-β superfamily in stress tolerance in scallops.
Conclusions
The present study is the first report of a comparative genome-wide characterization of the TGF-β superfamily in scallops. All three scallop species had the same number of TGF-β superfamily genes. The phylogenetic tree supported that these genes were grouped into 11 clusters. Selective pressure analysis showed that the scallop TGF-β superfamily has evolved under strong purifying selection. The spatiotemporal expression of TGF-β genes suggested that different TGF-β members have diverse functions in growth and development. Furthermore, the results provide insight into the potential effects of the TGF-β superfamily on gonadal growth/maturation and stress tolerance in scallops. Taken together, our findings provide global insights into the phylogeny and expression patterns of TGF-β superfamily genes, which are multifunctional cytokines capable of regulating a wide range of cellular behaviors in scallops.
Methods
TGF-β sequence identification
The genome and annotation files of three scallop species, including A. irradians, C. farreri, and P. yessoensis, were downloaded. The transforming growth factor β-like domain query (accession: PF00019) was first downloaded from the InterPro database (https://www.ebi.ac.uk/interpro/). The HMMER package V3.3.2 was then used to search for TGF-β proteins in each genome. The initial threshold expectation value was set to 1. The non-redundant sequences were analysed for the presence of the PF00019 domain using online SMART analysis [60] with a threshold of 1e-5. The protein sequence characteristics of TGF-β in three scallop species, including amino acid length (AA), molecular weight, isoelectric point (PI), instability index (INS), aliphatic index, and grand average of hydropathicity, were predicted using TBtools software v1.098 [61].
Phylogenetic analyses
A set of TGF-β protein sequences from 19 different species was obtained from the NCBI databases (Supplementary Table S3). All 164 TGF-β sequences, including the retrieved proteins and those identified from three scallop species, were used to construct the phylogenetic tree. Multiple sequence alignments were first generated using MAFFT v7.158b [62]. Phylogenetic trees were then constructed by using IQ-TREE v2.2.0 with the option -m MFP --bnni -B 4000 -T AUTO [63]. Phylogenetic trees were visualized using the iTOL (interactive tree of life) online tool (https://itol.embl.de/) [64].
Gene structure and protein domain
To illustrate the exon-intron structure of the TGF-β genes, TBtools software was used to generate the gene structure. The MEME website (http://meme-suite.org/) was used to discover the conserved motif of the scallop TGF-β proteins with the following parameters: maximum length of the conserved motif, 100; minimum length, 6; maximum number, 20, and default values for other parameters. The generated preserved motif files were visualized using the iTOL online tool. In addition, the conserved domains of TGF-β proteins in scallops were analysed using the Batch SMART plug-in in TBtools software.
Selection pressure assessment
Selective pressure was assessed by using the branch and site model in EasyCodeML V1.0 with the default parameters [65]. The branch models assume that the ratios (ω) of nonsynonymous substitution sites (dN) and synonymous substitution sites (dS) vary among branches. For the branch models, the comparison of two models (one ratio and free ratio) was calculated to test whether ω differs among different branches. The site models assume that the ω ratio varies among sites. In the site models, the specific models (M0, M1a, M2a, M3, M7, and M8) were tested by adjusting the parameters. Among these models, the comparison of M3/M0 was used to detect whether the ω ratio was consistent between different sites, while the comparisons of the M2a/M1a and M8/M7 model pairs test were used for positive selection.
Expression profiling of TGF-β superfamily genes
To understand the spatiotemporal expression patterns of TGF-β superfamily genes in scallops, publicly available RNA-seq data from two scallops were downloaded from the NCBI SRA database (Supplementary Table S4). Raw RNA sequencing reads were trimmed using the NGStoolkit program with the default parameters [66]. The reference genome was then indexed, and the clean reads were mapped to the reference genome using HISAT2 [67]. After the resulting SAM files were converted to BAM files and sorted using SAMtools [68], the transcripts per kilobase per million mapped reads (TPM) value of each gene was determined using StringTie v2.1.7 [69]. TPM values < 1, <5, < 15, <40, < 80 and < 150 were classified as no expression, low expression, moderate expression, high expression, and very high expression, respectively. Heatmaps of the gene expression levels were generated by using the ggplot2 package in R software [70]. In addition, to determine whether TGF-β superfamily genes were involved in environmental stress, RNA-seq data for three scallop species under heat, hypoxia and heat plus hypoxia stress were downloaded from the NCBI SRA database (Supplementary Table S4). Raw transcriptome sequencing files were processed using the same method as described above. In addition, the read count matrix was generated by python script “prepDE.py”, and the significance test of difference analysis was performed using DESeq2 1.42.0 [71]. P values were adjusted using Benjamini and Hochberg’s approach for controlling the false discovery rate (FDR). Genes with padj ≤ 0.05 and |log2(fold change)|>1 were considered DEGs. All steps were performed on a desktop computer in a WSL2 environment (Ubuntu22.04) with 12 cores, 64 GB RAM, and 5 TB hard-disk.
Application of quantitative real-time PCR for expression profile validation
To assess the transcriptome sequencing findings by RT-qPCR, CfTGFβ-01, CfTGFβ-02, CfTGFβ-03, CfTGFβ-05, CfTGFβ-08, and CfTGFβ-09, were selected randomly. The male gonad, female gonad, mantle, striated muscle, eye, foot, hepatopancreas and gill were collected from 9 healthy C. farreri scallops, and three individuals were put together as one sample. TRIzol reagent (Gibco BRL, USA) was used to extract total RNA from tissues. cDNA was synthesized using the PrimeScript™ RT reagent Kit with gDNA Eraser kit (Takara, Japan). The RT-qPCR reactions were carried out using SYBR (TOYOBO, Osaka, Japan). The gene-specific primers were designed using Primer 5.0 (Supplementary Table S5), and actin was used as the reference gene [72]. There were four technical duplicates of each sample during RT-qPCR. Finally, the relative expression level was calculated with the 2−ΔΔCT method, and the RT-qPCR results were compared with the transcriptome data.
Electronic supplementary material
Below is the link to the electronic supplementary material.
Acknowledgements
Not applicable.
Author contributions
Q.Z. and J.M.C. conceptualized and designed the project. Q.Z., J.Y.L., J.B.G. and W.W. contributed to the data collection. Q.Z., J.Y.L. and J.B.G. analysed data. Q.Z. and W.W. wrote the draft manuscript and J.M.C. reviewed the manuscript. All authors have read and approved the final manuscript.
Funding
This work was supported by the Fuzhou Science and Technology Planning Project (2022- P-002), the Natural Science Foundation of Fujian Province (2021J05211), and the Fujian Provincial Central Guidance Local Science and Technology Development Project (2021L3031).
Data availability
The datasets generated and/or analyzed during the current study are available in the NCBI repository [PRJNA259405, PRJNA428789, PRJNA185465, PRJNA259405, and PRJNA786240], [PERSISTENT WEB LINK OR ACCESSION NUMBER TO DATASETS], cfbase [http://mgb.ouc.edu.cn/cfbase/html/].
Declarations
Not applicable.
Not applicable.
The authors declare no competing interests.
Footnotes
Publisher’s Note
Springer Nature remains neutral with regard to jurisdictional claims in published maps and institutional affiliations.
Contributor Information
Jianming Chen, Email: nc.ude.ujm@mjnehc.
Wei Wang, Email: nc.ude.ujm@zs.wgnaw.